GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
3.0

Based on 857 opinions finded in 3 websites

site_photo4

Nº 1069 in 1203 in Northumberland

Nº 45 of 47 Indian in Northumberland

CUSTOMERS TALK ABOUT DISHES WITH..tandooribeautifulcookedcurryspicygarlicchickenprawnschillilambricemeatonionburnt

comment_iconOpinions

Have to say it has to be the worst food I've had from a take away. Undercooked bread and barely edable food. Will not be using again. Could be a bad day but .....

site_logo

Martino Lounge . 2024-12-10

MORE AT Google

Waited over an hour past specified time, ended up ordering elsewhere, absolutely terrible service. No communication nothing, what a let down, they used to be great

site_logo

Jessica F . 2024-12-02

MORE AT TripAdvisor

Food delivery was 30 minutes late. Not best curry we have had. Very bland

site_logo

Bandicoot . 2024-10-27

MORE AT Google

Not what it used to be, nan was tiny, little meat in the curry

site_logo

Ronnie Langston . 2024-06-16

MORE AT Google

Food was cooked like poo and didn't enjoy but they were very cool

site_logo

Tom Freeman-Wright (Flixity) . 2024-02-12

MORE AT Google

Food was not cooked and he offered me out in the back because i asked for the grimace shake and a kebab wrap i was quite scared but nice place

site_logo

Taylor Fairbairn . 2024-02-12

MORE AT Google

Best takeaway for gluten free and vegetarian! They called me after I placed my order to walk me though the ingredients to make sure I was okay with them then when it arrived the bag and each item was labelled as gluten free! Absolutely amazing good! The delivery driver is so canny too! Wouldn't order anywhere else!

site_logo

Charlotte Elise Whitfield . 2024-01-25

MORE AT Google

Food was freezing cold and very salty

site_logo

John Matthews . 2024-01-20

MORE AT Google

Cold on delivery, Balti tasted of raw spices and nann bread was like shoe leather

site_logo

Christine Hall . 2023-12-02

MORE AT Google

The mixed kebab starter garlic mushroom and soft cheese nan....these where absolutely amazing... The girl who answered the phone very polite and High manners... If £16 gets a deep fried chicken burger from a certain place Forgot the waiting area in here and enjoy the unreal mix kebab

site_logo

G . 2023-08-21

MORE AT Google

Word of warning to anyone visiting the Ashington area… over 2 hours delivery once the food had arrived the best part was the poppadoms and that’s saying something. Phones a few times and and apart from a lovey girl answering once was just met with arrogance and rudeness.

site_logo

Jordan Marshall . 2023-07-16

MORE AT Google

Food was awful. No taste. The curry sauce was runny and the nans were horrible. Never again

site_logo

Tracy Emmerson . 2023-07-07

MORE AT Google

Have reg takeaways and food always amazing and used them for a large order for my daughter's party good price amazing quality and bang on delivery time thanks so much

site_logo

Samantha Millar . 2023-05-26

MORE AT Google

Got a delivery use this place all the time usually lovely..not tonight naan bread like burnt toast ..tikka masala more tasting of bbq sauce not nice at all. Will not be using again

site_logo

leanne mcgregor . 2023-04-13

MORE AT Google

We've had many Indian takeaways, and I can honestly say this is the worse meal we have ever had. All starters and main meals were just not edible and had to be binned. Such a shame. A complete waste of money. We were offered a discount next time which we politely declined!

site_logo

Anita B . 2023-04-09

MORE AT TripAdvisor

Paid 4o pound disgusting meal will not be back stay well clear

site_logo

Scott Robinson . 2023-04-02

MORE AT Google

Very disappointed. Chicken Korma tasteless, unedible. Sauce looked like apple sauce. Chicken really tough. Burnt popadoms. Vegetable Bhuna looked like mush. We won't be back.

site_logo

Sam Willcox . 2023-03-24

MORE AT Google

Will never ever order from here again food was an hour late , not cooked properly , bread tasted of mould , and the chicken and lamb tikka had that much salt on it didn't even taste of tikka and we couldn't eat it! I might aswel have had a pint of sea water, total disappointment and waste of money!

site_logo

Kelly Leigh-cape . 2023-03-20

MORE AT Google

I have been eating Indian food since the 70s and I can safely say this is the worst Indian food I have ever had!!! Totally inedible!

site_logo

Alyson Blythe . 2023-02-18

MORE AT Google

Dirty kitchen dirty food broken sink boss very Rude clue less staff lack of knowledge and experience Totally Rubies?

site_logo

Mohammed Huda . 2022-10-08

MORE AT Google

Food was absolutely awful. So bland and flavour-less. Shame because it actually looked great and we were starving but honestly I don't know how they managed to get it all to taste of nothing. Very disappointing. Wouldn't go back.

site_logo

Daniel Hall . 2022-10-01

MORE AT Google

Absolutely stinking £27 for Teaka curry chicken tikka masala 2 naan and 1 rice didn’t bring me can of coke and got the wrong rice naan was all dry and hard

site_logo

Billy Rutter . 2022-05-07

MORE AT Google

Ordered food at 18.34, nothing arrived, restaurant's not answering phone . Complained via food hub and requested refund.

site_logo

Mandy Horner . 2022-03-30

MORE AT Google

Absolutely shocking portion sizes, prices and delivery charges. 😑 avoid this place.

site_logo

L91 . 2022-03-08

MORE AT Google

Beautiful! Never had a bad order from here. Tried the Lamb Biriyani for a change tonight and it was amazing. Xx

site_logo

Kirsty Dixon . 2022-02-19

MORE AT Google

waited 2 hours for delivery and phoned to see where order was to be told it would be at least another half hour as really busy my meal had not even been started to be made. tried to cancel order and was told had to go through uber eats for a refund. spoke to uber eats who told me it was take aways job to cancel. after wasting another half hour trying to sort out finally got the take away to cancel the order. avoid

site_logo

ayrey75 . 2021-12-29

MORE AT Google

Quick service time despite ordering late. Food lovely, piping hot on arrival and drinks chilled. Come here often for collection but first time ordering a takeaway and not disappointed, will return 👍

site_logo

Jenifer B . 2021-11-22

MORE AT TripAdvisor

Shocking service. Ordered via UberEats at 19:30 - arrived at 22.10. Rang restaurant to enquire and they said it was extremely busy. Food was nice enough and hot enough, but the length of time it took to get here is unacceptable so I will not be ordering again.

site_logo

K Pollard . 2021-10-12

MORE AT Google

Food was late, one kids meal completely missed off, part of my meal had been sent somewhere else. Food was bland, popperdoms were soggy as if they'd sat out all week. The only help I got on the phone at the other end is 'well give you credit next time you order' I'm sorry but how is that going to feed the child now!? Never ordering from here again. It's only got 1 star because I can't post without it

site_logo

Adam Costley-Wood . 2021-10-07

MORE AT Google

Since moving from London we haven't been able to find anything similar and this was totally amazing food very good delivery time would defantly reccomend.

site_logo

jon moore . 2021-09-08

MORE AT Google

Was looking forward to a take away curry, was very disappointed. Won't be ordering from here again. Very bland, gona start collecting from Masala.

site_logo

Steven Laws . 2021-07-10

MORE AT Google

I stopped using these for a while thought I'd give them another try lots of water in rice korma not good chips dry i won't be using them again.

site_logo

Joanne Scott . 2021-07-03

MORE AT Google

Charged me 34pound for 2 lamb tikka masala 3 nan bread 3 kemma rice left poppadoms of order and mint sauces said it wasn't on the order dam rude on phone won't be back

site_logo

tv tunes brogan . 2021-04-09

MORE AT Google

I wouldn't have given them any stars if I could I've ordered twice now and yet I still haven't received my delivery

site_logo

Daniel Lashley . 2021-03-29

MORE AT Google

Its a pity i have to give this rubbish a star got 2 meals tonight both went in the bin. My brother was getting one so i asked him to order us one each. Worst meal we ever had . Had nothing to eat all day so was looking forward to a nice meal. Never again from this so called restaurant.

site_logo

William Wright . 2021-02-27

MORE AT Google

Ordered on Uber Eats. Delivered on time but the food was very bland and tasteless. Rice was a bit on the hard side and prawns tasted vile. Would not recommend.

site_logo

Colin Wright . 2021-02-27

MORE AT Google

We had a pair of curry's from here a while back and the duck nearly finished my wife off. She was VERY poorly, we won't be back...

site_logo

Bryan Dixon . 2021-02-26

MORE AT Google

Nothing but the best from my best friend's dad's takeaway !

site_logo

Andy's Transformer Crisps . 2021-01-08

MORE AT Google

After waiting 2hrs food didn't even turn up AVOID!!!! Terrible service,never again absolute waste of time.

site_logo

Tompa1972 . 2020-12-12

MORE AT TripAdvisor

Ordered tonight absolutely fantastic

site_logo

Sharon Wilson . 2020-11-22

MORE AT Google

Objectively, Abbey Tandoori has always been my number 1 Indian takeaway. I love Indian food so I will try others. I've moved away from the area but I'm still going back as its head and shoulders above the outlets in Morpeth. The Tandoori, Dansak & nan breads are all top notch. Get the Dansak extra sweet. I could eat it with a peshwari nan 8 days a week.

site_logo

Steel Kneel . 2020-10-12

MORE AT Google

Best Indian takeaway in Ashington There food and service was Amazing, highly recommended will definitely be back

site_logo

Rebecca C . 2020-09-28

MORE AT TripAdvisor

One of the best Indian Takeaway in Ashington Love it Fantastic qualitive and Tasty food ******👌👌👌👍👍👍

site_logo

P8948IOalexg . 2020-09-27

MORE AT TripAdvisor

We came from London for holidays with whole family And ordered food for whole family at ABBEY Tandoori Indian takeaway because of their Add on line 😎 We got the tasty hot piping food with perfect package and portions and price wise excellent Mix Grill and Ch Tikka Masala lush and fantastic Wr are many time in different places But This Indian takeaway we order and found almost everything according to our requirements We have 4 days of plan to stay here holiday sandy bay DEFINITELY we enjoy our indian meal with ABBEY Tandoori Thanks ABBEY Tandoori For god effort and services ******

site_logo

Tom Hudson . 2020-09-27

MORE AT TripAdvisor

The food is delicious always go here 💯❤️🌯🍜🍛

site_logo

Lorraine bella Thew . 2020-09-11

MORE AT Google

Very great tasting food! I would rate this the best Halal Indian takeaway in Ashington! I would recommend this place to everyone who like to eat Indian 👍👍👍

site_logo

Mujahid Iqbal . 2020-08-25

MORE AT Google

Paid for a full curry only received half! Used to be lovely Indians won't be coming back. curry was vile barely any taste just heat...

site_logo

CrazyShane HD . 2020-08-14

MORE AT Google

Stayed in Ellington for an short holiday and this takeout came recommended by the owner of the holiday let so we were looking forward to it. It fell way short of expectations, every meal was bland regardless of how much salt and pepper we added. Zero spices, every plate of food tasted the same regardless of what we had chosen. Felt we had wasted our money.

site_logo

Tayloj35 . 2020-07-24

MORE AT TripAdvisor

I ordered my meal tonight and a large piece of rock was in my food..he admitted and said i could have a free nan bread next time!! I wont ever go there again

site_logo

K5397CPnicolah . 2020-05-31

MORE AT TripAdvisor

Wife ordered chicken vindaloo and chicken ceylon this evening and I can honestly say it was the worst indian meal I have ever had...and we've eaten indian food all over the world! The naans were fine, as were the chips. However, my vindaloo was toxic with vinegar...to the point that it made me gag when trying to eat it. There was very little meat in the curry and my wife's ceylon was bland. I generally only leave reviews to praise good service and food quality, but I feel that the general public needs to be forwarned before risking their cash at this establishment. ...and yes, we will never go back.

site_logo

David Elliott . 2020-05-22

MORE AT Google

Our usual takeaway was closed so having read some reviews thought we would try Abbey, not the best idea we have ever had, to be fair the mixed tandoori was pleasant although the lamb was over cooked and tough, the chicken balti was not nice at all and most of it ended up in the bin, and the nan bread, not sure what was going on there? I appreciate this are difficult times and all credit for continuing to provide a service, but this was not an enjoyable meal at all.

site_logo

Aldo_Sand . 2020-03-31

MORE AT TripAdvisor

Ordered our food at 7.20 and was informed it would be 35-50 minutes. Arrived 9.43pm. By which point I’d had to put my son to bed with toast for tea instead of planned takeaway. Called at 8.30 and told it would be 10-15 mins. On arrival onion bhaji, chips and rice were cold and curries were warm. Needed to heat it all up. Tasted ok but lost the crispyness when heated and grease separated.

site_logo

459carrieannem . 2020-03-29

MORE AT TripAdvisor

Food arrived cold as if it hadn't even been attempted to be heated up, rang and all I was told was that they were too busy to resend my order or to refund it..... 13call attempt later and they put phone down as soon as they realise its me ringing

site_logo

Daniel Evans . 2020-02-01

MORE AT Google

Haven't been here for a while, still very good - first time I've had the pickle tray its £3 and you get six different tubs of pickles and sauce. Its nice to chomp through some of the nan bread and pickle tray as a starter.

site_logo

Colin Craig . 2019-12-28

MORE AT Google

Ordered on just eat then cancelled order after realising the delivery and service charge cost. We then got a call from Abbey and continued with the order without stupid extra charges. Recieved order within 30-40minutes. Thoroughly enjoyed every bite absolutely lush. Will definitely be back again yummy

site_logo

Maria Pearce . 2019-10-05

MORE AT Google

First and last time I time I will order from here. Just about everything I got was swimming in oil and very greasy, naan bread was cremated and very little meat. I hadn't had a indian's for a long time so was so looking forward to it and ended up being such a let down, wish I just got a Chinese with the other half now!

site_logo

Dean Dixon . 2019-07-30

MORE AT Google

Undercooked chicken theres hoping we not sock

site_logo

Kirsty Adamson . 2019-05-24

MORE AT Google

Been a customer for a long time, ordered a meal last night which was way below standard. Won't be back

site_logo

John Langan . 2019-05-16

MORE AT Google

Used to like the place left feeling disappointed on the last visit won't be back for a long time

site_logo

Lee Arkle . 2019-04-25

MORE AT Google

Good price great service Always arrives steaming hot

site_logo

Andrea . 2019-04-12

MORE AT Google

There’s not much to choose from on Ashington, but everywhere else is better than this. The food is average and the service is just dreadful.

site_logo

329alc . 2019-04-11

MORE AT TripAdvisor

Had two bad experiences with Abbey Tandoori the last two times I've used this restaurant, first time was for a delivery two weeks ago I rang in my order and was told it would be an hour fair enough it's Saturday night busier than usual no probs, it didn't arrive until over and a half later by which time we no longer wanted our meal, the driver was appologetic enough but I explained if I was told it would be this long on the phone I wouldn't of ordered, this leads to my second experience tonight, after the last order we decided to ring our order in and to pick it up ourselves which was fine I thought until I got home with it and the wife told me I had been over charged so to check I went onto just eat and tallied it up and indeed I had, not by a fortune but its not the point, so all in all I won't be using Abbey Tandoori again as the food is much the same standard you can get at all the Tandooris in Ashington though it used to be a lot better.

site_logo

666robl . 2019-04-06

MORE AT TripAdvisor

12 of us placed an order on a Saturday night before 7pm. Were told it would take about an hour. No sign of it by 8.15 so we phoned to ask. Initially we were told it was on it's way but when pressed the woman admitted it hadn't been cooked yet. Had we not paid up front by credit card we probably would have cancelled order at this point. It eventually arrived about 9.20, barely any apology, and certainly no money off for delay. Food itself was lots of sauce, but not much chicken/veg. If you do decide to order from here, we'd advise not to pay upfront, make sure you order hours in advance, and be prepared for mediocre food.

site_logo

984Anonymous . 2019-04-02

MORE AT TripAdvisor

I recently spent £34.90 on a takeaway from here , although it tasted ok the quality of ingredients they used were terrible the least expensive dishes like the chicken Korma were not to bad ,however my king prawn tandoori masala was an absolute joke there was probably 2 prawns in the whole dish and they had been cut up to make it look like there was more in it , this was an absolute disgrace , I will not be going back there ever.

site_logo

G8606MXtomh . 2019-03-13

MORE AT TripAdvisor

They charged 7 quid for three popadom and pickles and the pickles containers are the smallest ever a rip off food is ok

site_logo

karl newbiggin . 2019-02-16

MORE AT Google

Watered down curry, it was really runny not what I expected. Over cooked chips and under cooked naan bread. Not good at all.

site_logo

NorthumberlandMam . 2019-01-23

MORE AT TripAdvisor

Basic but nice Indian takeout cuisine,variable choice of Indian dishes available here with home delivery option available,good place for a cheap Indian takeout meal

site_logo

Christopher John . 2018-08-04

MORE AT Google

Ordered from here a few times, was hit and miss. Sometimes nice, sometimes awful. Found out it recently got scored 0 on food hygeine so won't be trying it again until it improves.

site_logo

Sam D . 2018-07-06

MORE AT Google

Went massively downhill since last owner left keema naan consists of a red colour no meat I just use this company all the time I don't use it anymore

site_logo

Karl Robinson . 2018-05-27

MORE AT Google

Nice meal and mouth watering taste of this take way in whole Ashington Numero unooooo👍👍👍👍

site_logo

Iqan . 2018-05-05

MORE AT Google

Food is fantastic service is great

site_logo

robert davison . 2018-04-17

MORE AT Google

Sat all week in hospital having not very tasty meals. Asked nurses about take aways in and around ashington. The abbey tandoori was the first one to offer delivery to the hospital. Absolutely lush best tandoori meal I've had in awhile was as good as the Indis valley, Hexham . Spot on

site_logo

Gordon Hindson . 2018-04-15

MORE AT Google

Number one take way in Ashington

site_logo

Mujy Chicagian . 2018-03-27

MORE AT Google

Good delivery time but starters arrived cold and had to be reheated. Nann bread was.like a brick! £4.95 for delivery that is local bit of a rip off.

site_logo

clairethetraveller . 2018-03-26

MORE AT TripAdvisor

So, placed delivery at 18.45 18/3/18  for £13.55 (confirmation at 18.58 from the APP/Outlook - have all the screenshots & now calls that are recorded and times recorded also) for 19.40 delivery (after an already revised time from 19.35) & at 20.11, no delivery or any communication to advise will be late. Appreciate the weather has been bad (left full instructuons as to where the new build is also for delivery, as not on Sat Nav but "Morpeth" gives the clue to the address yet they go to Longframlington after I'd provided the CORRECT address and postcode ) but when I called the guy (at the Abbey) who answered, he advises that they are busy & will be another 15 mins, so expected at 20.26ish (as call being ended, can hear him saying 'get this order out as soon as'). Totally shocking service & extremely unprofessional, NOT happy. £4.95 delivery fee also... surely for £4.95 should expect delivery and quality of service ontime as agreed via the APP and agreement?! Will NOT be using again as TOTALLY awful service as over overdue for delivery and over 2 hrs from time purchased & have now refused delivery as it's far too late for food or satisfaction now from these charlatans!! Think they ought to refund... but know they won't NOT delivered and it's 21.28, when I speak to them they accuse ME of being in the WRONG and are extremely argumentative/making all the excuses they can under the sun. NEVER USE THESE PEOPLE!! 

site_logo

Neil C . 2018-03-18

MORE AT TripAdvisor

Loved my food everytime I visited.

site_logo

KPS . 2018-03-15

MORE AT Google

Food was awful and took ages to cook

site_logo

Steve Monaghan . 2018-03-06

MORE AT Google

Chips were not fresh! Rest of order lovely.

site_logo

Lindsay . 2018-03-05

MORE AT Just Eat

gets better and better every time :)

site_logo

chris . 2018-03-02

MORE AT Just Eat

Food really nice but took a long time to reach us.

site_logo

James . 2018-02-24

MORE AT Just Eat

Spot on, tasty hot food delivered on time. What's not to like?

site_logo

Felicity . 2018-02-24

MORE AT Just Eat

Usually good with delivery times but over 1 hr late, busy night for Valentines. Lovely food as always and order correct. However poppadom was crunched to bits...

site_logo

Lindsay . 2018-02-14

MORE AT Just Eat

The food was lovely but it came very late.

site_logo

cath . 2018-02-14

MORE AT Just Eat

the best Indians in ashington always top notch👍🏼

site_logo

steven . 2018-02-11

MORE AT Just Eat

Best takeaway curry going, couldn't recommend it more!

site_logo

Matthew Moffatt . 2018-02-11

MORE AT Google

Ordered a vegetable masala which was a few peas (no exaggeration at all I went fishing for veg and all I found were peas!) In masala sauce that was as sweet as a dessert. I binned it. Total waste of money. Very disappointed and wouldn't order there again.

site_logo

Chris . 2018-02-10

MORE AT Just Eat

Food was oily and not very nice tasting only tried here as our regular was shut don’t think we will be back again

site_logo

bianca . 2018-02-06

MORE AT Just Eat

Chilli Garlic Chicken (Hot) was lovely. Always order the Abbey Fajita, lovely food.

site_logo

Lindsay . 2018-02-03

MORE AT Just Eat

lovely first time ordering from here. will return

site_logo

Helen . 2018-02-02

MORE AT Just Eat

Not too bothered about it being a little bit late but paying £6 for chicken tikka masala and you get like 4 pieces of chicken in it? And enough sauce to take a bath in. Chips were cold within 5 minutes of having them on my plate.

site_logo

Shantell . 2018-01-21

MORE AT Just Eat

Abbey special madras was nice, won't be ordering chips again as they were not nice or cooked properly

site_logo

Lindsay . 2018-01-17

MORE AT Just Eat

Chicken was a bit fatty, not normal standard.

site_logo

Lindsay . 2018-01-09

MORE AT Just Eat

Order was wrong and took over 45 minutes for the replacement nan to arrive which was also wrong. Delivery price is a joke!!!!

site_logo

Sarah . 2017-12-31

MORE AT Just Eat

First time at the Abbey Tandori and the food was fantastic... Will definitely be visiting again soon,I would give a 5* for the chicken pathia. Well done Abbey****

site_logo

Hazel . 2017-12-31

MORE AT Just Eat

Nan breads were a little bit tough but overall spot on.

site_logo

Steve . 2017-12-26

MORE AT Just Eat

Food was 2 hours late called the resturant and was told it was on the way it took an hour to arrive after two phone calls from the driver. As you can imagine it was freezing cold wont be using them again even with the offer of half price off next order due to poor service

site_logo

Andrew . 2017-12-09

MORE AT Just Eat

excellent service and excellent quality meal for the price , will definitely order from here again.

site_logo

Trevor . 2017-12-09

MORE AT Just Eat

We have a take away delivered from the Abbey almost every week. Food is great, nice and hot and you don’t have to wait too long for it to be delivered, love it.

site_logo

joanreed4 . 2017-12-06

MORE AT TripAdvisor

I can't fault the quality and quantity of the meal. as well as the quick delivery service.

site_logo

Trevor . 2017-11-18

MORE AT Just Eat

really nice might be the best in ashington would definitely order again

site_logo

steven . 2017-11-11

MORE AT Just Eat

Similary restaurants in North East

restaurant_img
3.3

107 Opinions

location-icon1 Wright Street Blyth, Newcastle upon Tyne NE24 1HB England
Indian
outdoor_seating_250899takeaway_250899delivery_250899

Terrible service, ordered via uber eats, had a 1 hour wait, 5 minutes before the 1 hour time limit they cancel order. Avoid this place for delivery

restaurant_img
3.5

67 Opinions

location-icon34 Glebe Road, Bedlington NE22 6JT England
Indian
outdoor_seating_262560takeaway_262560delivery_262560

First time and last time chips are frozen chips the curry tray was half empty

restaurant_img
4.0

852 Opinions

location-iconOld Station House
Indian
outdoor_seating_174342takeaway_174342delivery_174342

We've had many brilliant family meals here in the past but our recent family dinner was a really bad experience!!! We had a table booked for 5.30 as we had a few kids with us (1 month old, and 2,8 & 10 year olds). We weren't sat at the table until 6.20 (they held us downstairs at the entrance/bar area for this whole time). Once sat at the table our food they didn't arrive until 7.20 (the time we had hoped to leave to get the kids to bed!!). If you book a table for 5.30 you don't expect to be waiting for the table for almost an hour, and for the food to arrive almost 2 hours after arriving. Really poor management overall. The restaurant were clearly too busy, and the staff had no desire to help us out as a family with small children, despite us asking; can we order, be sat at our table, where's the food etc there was no info or effort made to make it work for us. They had just clearly over booked the tables. We highly recommend this place for the food, and if you're a party of adults, but I'd avoid this place if you're hoping for a relaxing family meal (it was raucously loud, even at 6pm!). With a heavy heart, we will sadly be avoiding this place for a while.

restaurant_img
4.0

927 Opinions

location-icon15 West Wylam Drive
Indian
outdoor_seating_223248takeaway_223248delivery_223248

The Best. So polite and the food is always excellent. What more can one say

restaurant_img
4.0

51 Opinions

location-iconArden House
Indian
outdoor_seating_143440takeaway_143440delivery_143440

The Tandoori shop is a small counter at which you order food to take away; there’s no seating except a bench on which to wait for your order. You do wait (e.g., 20 minutes), which is fine because the food is made when you order. For a small takeaway place, the menu is huge: every assortment of Indian fare you could want—plus pizza. You can pick the proteins sauce, type of rice. The food is good and a good value (even if there’s more sauce than protein)—especially the naan.