GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.3

Based on 812 opinions finded in 2 websites

site_photo4

Nº 390 in 809 in Calderdale

Nº 69 of 133 British in Calderdale

CUSTOMERS TALK ABOUT DISHES WITH..lamboldcookedroastharesteakbeautifulpuddingcheesepiechickenfishmeatpastryonion

comment_iconOpinions

Absolutely fantastic service for my Great Grandads 91st birthday. Food was incredible, really kind and bubbly staff, thanks for making a special occasion extra special! We will be back, as always!

site_logo

Lauren Jackson . 2025-01-26

MORE AT Google

What an amazing time, we stayed one night The location is beautiful, the staff and there regulars were amazing and proved what makes Yorkshire so friendly We slept in room 4, we have absolutely no problems it was a beautiful room, comfy beds clean bathroom Food wise we have eaten there before and it was delicious Plenty of drink choices Thank you for the amazing night, we look forward to our next stay with you

site_logo

Chris Ambler . 2025-01-25

MORE AT Google

Lovely venue love the pies on the menu definitely recommend it to friends and family

site_logo

Tom Page . 2025-01-24

MORE AT Google

Had a lovely family meal, pies are amazing would 100% recommend coming, staff are welcoming as well !

site_logo

Tara Coyle . 2025-01-24

MORE AT Google

A lovely pub, definitely would suggest anyone to pop in if they want delicious food with great service. The food was amazing, I got the chicken strips for starters and a pie after. Both were fab. The staff were lovely too, very welcoming the entire time. I definitely plan on going back again. If you’re around the area i definitely recommend you popping in.

site_logo

remmy coyle . 2025-01-24

MORE AT Google

Came here for a couple of nights, had an amazing stay and staff were very friendly and always happy to help, the food was top notch, had a chat with James about his rugby career very interesting man, we will definitely be coming again

site_logo

Paige Banks . 2025-01-24

MORE AT Google

Beautiful location, great food and welcoming staff. What more could you want from a country pub?

site_logo

David Stout . 2025-01-23

MORE AT Google

What a lovely pub set in idyllic surroundings high above Hebden Bridge, it's location is a bit out but this only adds to the magnificent scenery. The staff in the pub were ever so friendly and nothing was too much trouble, they were attentive but not obtrusive. All in all a great evening out with my wife which was only made nicer by how we were treated by the pubs staff.

site_logo

trevor rhodes . 2025-01-13

MORE AT Google

Some of the best views in Calderdale There’s Goats , runner ducks and other animals for the kids. A Clean , tidy and nicely decorated Bedroom. The Food was gorgeous. A Lovely bar and choice of Timothy Taylor ales and more + pub dog ‘Bear’. Such warm and Friendly staff , and Landlord. Felt like home and I didn’t want to leave.

site_logo

Stuart Fielden . 2025-01-12

MORE AT Google

Great pub, friendly service. Must visit to try the homemade pies especially!

site_logo

George Collins . 2025-01-12

MORE AT Google

Such a shame. Love this place, but today’s lunch and service wasn’t what we expected. The food seemed to have been reheated a few times. Pies were too hard. The fire should have been lit in the morning. We requested a table by the fire with the fire on. It was slowly burning and freezing for the entire stay. I hope next time we go, the service and food is what we expect from such a lovely place..

site_logo

Belinda Firth . 2025-01-12

MORE AT Google

Had a lovely Christmas dinner here with friends. Good food, warm and cosy atmosphere and the staff were amazing. Special thanks to Millie who was super efficient, helpful and delightful. Nothing was too much trouble for her. An added bonus that our dogs were made welcome too. Thanks to all and we will be back soon

site_logo

Fliss Allen . 2025-01-01

MORE AT Google

We had the pleasure of Christmas Day 🎄 lunch here. Outstanding experience 👏🏼 Made welcome from start to finish as always and the food was just AMAZING. Definitely a return visit is in order ⭐️⭐️⭐️⭐️⭐️⭐️

site_logo

Daniel Grayson . 2024-12-27

MORE AT Google

We booked Christmas Day lunch and it was outstanding. We felt incredibly welcomed and the food was delicious. We were seated by the fire which was cosy. Thank-you for looking after us. We’ll be back soon. Merry Christmas x

site_logo

Lisa Graham . 2024-12-27

MORE AT Google

Brilliant location, food and staff. The only reason for 4 stars is that not everybody likes dogs, especially when eating. Luckily the gentleman moved after we ordered. A dog free area would be good for people.

site_logo

Kyle Irvin . 2024-12-14

MORE AT Google

Only went for food. Half the mozzarella sticks were inedible. The chef put it down to "freezer burn," which put me off the food a bit. I don't think I'd go back again as it's quite a trip and to be honest there's better pubs around. I left a review on Facebook, and the replies I got were extremely unprofessional and they lied, saying the chef offered us a free drink as compensation, which they didn't. The chef only came to see us because she knew my friend, who I was dining with. The customer service is worse than the food. *Edit to add We have now been offered a free meal AFTER I left a poor review but after all the lies and trying to make me look bad I have declined. I have added screenshots before they get deleted.

site_logo

cala missangeleyes . 2024-12-09

MORE AT Google

Visited as a group of 12 for a birthday meal at very short notice a few days ago . The staff did an excellent job at arranging a large table in very little time and preparing food mid afternoon , it was excellent, high standards and really enjoyable , the food was served all as one without much delay and decent portions. Very friendly and warm too. Brilliant beer garden and very quirky which i like, great views also. Top marks and thankyou 😊

site_logo

Iain Newby (Spaceport7) . 2024-12-03

MORE AT Google

An excellent pub situated in the Yorkshire Dales, the Hare and Hounds, offers fine dining at an affordable price. The staff were all very friendly, professional, and most accommodating. The food was delicious, and unlike most places these days, they were very generous with their portions. I had the halloumi fries starter and the roast chicken dinner for my main. Both dishes were superb! The drinks are also reasonably priced, and I would recommend the Timothy Taylor beer on draught. The interior of the pub is as one would expect from a rural establishment: quaint, rustic, and cosy. A roaring fireplace completes the picture. There are picturesque views to be had of the surrounding countryside and in the back garden the pub keeps a number of ducks and geese-a must see if you bring the kids along! However, the carpark is tiny and very tight to manoeuvre in. Also, access may be slightly difficult for those who are disabled. In all, I would thoroughly recommend the Hare and Hounds, although it would be prudent to book beforehand.

site_logo

Andrew O'Brien . 2024-11-18

MORE AT Google

Waited for an hour for our food order. When it came there was no lamb in the lamb hot pot, vegetables were cold as was my friends roast chicken. It was so bad they took the lamb off the bill. Yorkshires were clearly from a packet. Avoid.

site_logo

norwichLondon . 2024-10-28

MORE AT TripAdvisor

We ate here on a Thursday evening to celebrate the final night of our holiday. We felt scammed by the Thursday and Friday night "Eat-in" offer which was not applied to the bill for the roasts that we ordered. The waitress brought our menus to the table, said that the roast was beef, and asked us to order at the bar. She didn't say that any of menu was not available (which would have been helpful!). We originally chose options that wouldn't have qualified for the offer but when we tried to order them at the bar we were told that a lot of the items were not available due to refrigeration problems. So my husband chose roast beef and I not wanting to spend time going through the menu again and knowing that roast of the day was on the 2 mains for £20 offer (applicable at the time we were there) , also said I'd have roast. When we got the bill we were charged £16.50 for each roast. I said that the two roasts should be £20. However, the waitress said that as we hadn't specifically asked for the roast off the offer she couldn't put it through as that. She was adamant that that was what she had been told to do, and said that our roasts were bigger than the offer roasts. I subsequently looked at the menu and on the main menu it says "The Roast'est with the Most'est - roast dinners" and under the offer it says "Roast Dinner of Day". So firstly, I would question if most people would look at the menu and understand that these were not the same dish and secondly, if a customer asks for "roast" at a time when the offer is applicable shouldn't the waitress clarify which they want. Food was OK.

site_logo

Marion C . 2024-10-10

MORE AT TripAdvisor

Moved Oop North local to HB 6 years ago. Why has it taken us so long to check out this beautiful pub...lovely situation, good service and lush Sunday lunch. The vg roast was to die for. Other half had a giant Yorkshire pud with roast chicken. Reliably informed this was lush too. Will definitely be returning soon. 🥰

site_logo

Amanda Gilroy . 2024-09-22

MORE AT Google

The best roast dinner I’ve had in ages. And chips the size of my face! Definitely a firm favourite.

site_logo

Adam Devine . 2024-09-22

MORE AT Google

Beautiful quirky pub. Will be back. Decor something else. Definitely worth a visit

site_logo

ems (ems) . 2024-09-22

MORE AT Google

Came with my husband recently and particularly enjoyed the lamb koftas all washed down with probably one of the best half pints of diet coke I've had in the area. Will be coming here again for sure!

site_logo

Sam Hudson . 2024-09-19

MORE AT Google

Wow! This was our first visit to the Hare & Hounds and it most definitely won't be our last. This pub is really cosy with a friendly atmosphere and dogs are welcome! 🐕 The food is absolutely delicious. I had vegetarian nutroast, with Yorkshire pudding and vegetables, my wife had the meat (chicken) version. Both dishes were cooked to perfection - the nutroast was first class. Always room for pudding, I was served a generous helping of sticky toffee pudding and delicious custard 😋 Compliments to the Chef. We can't wait to return.

site_logo

Jamie L Campbell . 2024-09-16

MORE AT Google

Visited twice and was absolutely amazed by just how incredible the experience was, the food was amazing the views were breathtaking and the atmosphere so comfortable it was beautiful with the open fire and bustling atmosphere

site_logo

Allen Langham . 2024-09-14

MORE AT Google

The food is exceptional and the location and views are superb.The staff were friendly and attentive and the atmosphere warm and welcoming. Would deffo recommend trying this place

site_logo

Adrian Knight . 2024-09-14

MORE AT Google

Lovely food and a great atmosphere. Views from the decked area overlooking the Hebden Valley are well worth a visit on their own.

site_logo

Ian Richardson . 2024-09-14

MORE AT Google

The food here is incredible such a friendly service and great atmosphere will definitely be returning

site_logo

Ben Barker . 2024-09-13

MORE AT Google

Absolutely excellent scenic views lovely food

site_logo

Infinite Art . 2024-09-13

MORE AT Google

I go with my grandson for tea usually have cheese an onion pie which is one of the best I've ever had grandson has the cheeseburger which he wolfs down, big hearty portions, lovely cosy atmosphere big open fire, lovely helpful staff,and fantastic views across the valley.

site_logo

Claire Greenwood . 2024-09-13

MORE AT Google

Great pub, friendly staff and fantastic food. The pies 🥧 were delicious

site_logo

Sarah Beaumont . 2024-09-13

MORE AT Google

Outstanding pub and food lovely staff friendly staff, love going back to The Hare and Hounds.

site_logo

Tony Maunder . 2024-09-12

MORE AT Google

Fantastic food. Great service. Can’t fault the hare and hounds at all. We will be back !

site_logo

Jonny Wong . 2024-09-12

MORE AT Google

What a great venue! Awsome scenery and the food was fantastic definitely be going again

site_logo

Kayne Broadbent . 2024-09-12

MORE AT Google

I have stayed in many places, this is breathtaking and lovely cozy freindly pub, not to mention the food, proper pub food We will return

site_logo

Glenys Odonnell . 2024-09-12

MORE AT Google

Absolute love this place James and his team go above and beyond for all customers. Food is 10 out of 10 cant wait to be back

site_logo

Luke Lenihan . 2024-09-12

MORE AT Google

Gorgeous food in a stunning setting. Bedrooms very clean and comfotable. Have been there several times and loved every visit. Will be back soon.

site_logo

Julie Greenwood . 2024-09-12

MORE AT Google

really good quality food fantastic staff make everyone more than welcome and brilliant beers

site_logo

Nicole Watkins . 2024-09-12

MORE AT Google

Fantastic all round!! Great staff and stunning location.

site_logo

James Phillips . 2024-09-12

MORE AT Google

Brilliant cosy pub, with a great atmosphere and roaring fire in winter. It's in a beautiful rural location yet handy for Hebden Bridge which is a fabulous centre to visit. The staff were courteous and polite going out of their way to ensure we all had what we wanted and the home made food was splendid (great pies). We couldn't fault it and will go again. Chris and Chris F

site_logo

Christine Kerrin Ferneyhough . 2024-09-12

MORE AT Google

Beautiful pub food is outstanding rooms are lovely and clean all the staff are great and friendly

site_logo

Jonathun Lancaster . 2024-09-12

MORE AT Google

My husband and I have visited this establishment on a number of occasions for a meal and a drink. We have never been disappointed. Food is always cooked fresh to order and is plentiful. Staff are organised and friendly, especially James, the proprietor, who puts himself out to ensure that everything is perfect. There is a beer garden where you can take in the spectacular views. Also, walks and bike riding on hand. The rooms are clean with everything you could possibly need, and again, the views are amazing. Keep up the great work, guys!! We will no doubt be back very soon.

site_logo

Victoria Slater . 2024-09-12

MORE AT Google

Fantastic pub . Grear Food and beers . It has one of the best views of any boozer anywhere.

site_logo

Adam Greenwood . 2024-09-12

MORE AT Google

Lovely meal today, cheese and onion pie, steak n ale pie n gammon, we enjoyed them all

site_logo

Sue robinson . 2024-09-06

MORE AT Google

Room OK for space and furniture was OK too, but our room had a patch of mould, walls were paper thin so we could hear next door using the bathroom clearly and 2 pots of milk were out of date. Location is lovely. Pub drink prices were higher than local average and staff weren't too engaging, but the lady cleaning when we dropped the key back the next morning was very nice.

site_logo

Rob Dixon . 2024-09-03

MORE AT Google

Amazing place to stay. Delicious food, beautiful location and peaceful, chilled atmosphere.

site_logo

Sam Burgess . 2024-08-28

MORE AT Google

Went for tea recently on a Thurs for the meal offer. The food was lovely as was the service but £10 for a large glass of wine?!! I know prices have increased but really!!....

site_logo

Jane Hughes . 2024-08-12

MORE AT Google

Good food, good beer very accommodating but the beer has got way too expensive. £18 for 2 1/2 pints!

site_logo

John Whitehead . 2024-07-28

MORE AT Google

Excellent Service and the food was really enjoyable, no complaints from us. Dog friendly which made it more appealing and on a warm day would be nice to sit outside with a drink.

site_logo

Neal Procter . 2024-07-21

MORE AT Google

Four Timmy Taylors cask beers on offer and all are well kept. Not the cheapest pub around, but if you have to pay a bit more to keep it open, then so be it. Decent staff, friendly locals and cracking views across the moors.

site_logo

Ant D . 2024-07-20

MORE AT Google

We stayed here through an Air B&B booking. The room was basic but clean and comfortable. The staff is FANTASTIC, SO friendly and accommodating and we talked to them for quite a while after closing. We weren't able to eat as it was Father's Day and the place was booked solid, but the food looked really spectacular. Excellent views, pet-friendly, gorgeous quaint decor...what more could you want.

site_logo

Rebecca D . 2024-07-09

MORE AT TripAdvisor

Food was very good if not slightly overpriced. My beef dinner was lovely although don't think the Yorkshire puddings were fresh? I wouldn't have had a pint if I'd have known it was £6.70 for a pint of Moretti 😳 Staff were good, food came out fairly quickly Stunning setting so worth a visit

site_logo

Martin Culshaw . 2024-07-07

MORE AT Google

We ate there Saturday food was great but I had booked 4 weeks before that for farhers day NO BOOKING in dairy very snotty lady when I asked can I please have a table as I had booked I got a flat no and called a lier ......not good customer service

site_logo

Karenfall Fall . 2024-06-23

MORE AT Google

Cracking pub with great food and lovely views. My girlfriend and I were staying nearby and popped in one night for some food and drink. It was a little on the pricier side but I would not hold it against them as it was all well worth it for the quality. Genuinely some of the best pub food we have ever had, you'd think it had a Michelin star! We highly recommend the Yorkshire pudding wraps, absolutely unreal. Cosy little place inside, might have been roasting outside but the fireplace lit inside gave a lovely bit of ambience. Oh, and the views from the beer garden are something else. It was so good we came again for lunch a day later! Next time we come back to Hebden Bridge, we know exactly where to head first.

site_logo

Jacob Rowe . 2024-06-23

MORE AT Google

Lovely food, nice atmosphere 👌 😋

site_logo

Andrew Collier . 2024-06-21

MORE AT Google

Beautiful place to stay Staff friendly and go above and beyond Felt at home Room clean and tidy

site_logo

Just Doris . 2024-06-17

MORE AT Google

I booked fathers day & we have been twice before although a few years back, the landlord & landlady were hard working and focused on making it an enjoyable lunch experience. The food was always fab, fully stocked bar etc ....Today, not so good, different staff it seems so I wondered if the management was different?. Our food was fairly average, quite a few things made me wish I'd booked elsewhere. I'm not sure what has happened but it wasn't the same great experience, happy to discuss further if it helps 😞

site_logo

deanne p . 2024-06-16

MORE AT TripAdvisor

Lovely pub & staff, food & drinks good value.

site_logo

Alex Ridsdale . 2024-05-28

MORE AT Google

A warm welcome from friendly staff. Then it went down hill, drinks over priced, £6.60 for Guinness , £6.00 for cider! Fish and chips worst ever see , 2 thin goujon batter was thicker than the fish, chunky chips skin on, however the eyes and grit were also left on! The other meals were okay just over priced . Staying in the area and thought we would support the local. We will look elsewhere tonight!

site_logo

ANGELA I . 2024-05-19

MORE AT TripAdvisor

Really friendly pub, all the staff were very accommodating and made us feel welcomed.

site_logo

stefanaustin . 2024-05-15

MORE AT Google

We had a great Sunday lunch here. The staff were lovely and the service was great. The best bit by far is the view across the valley. Make sure you visit on a nice day and take full advantage of the outdoor seating!

site_logo

Phil Gannon . 2024-05-09

MORE AT Google

Price is extortionate. £5.60 for a pint of Timothy Taylors! Sorry, just too much. Nice pub and welcoming service. Shame. It was very quiet when we were there. No surprise at that price really. Hope prices come down.

site_logo

Einion Jones . 2024-04-20

MORE AT Google

Arrived early but wasn’t a problem for the team, who were just amazing throughout our visit. On table 7 next to a nice fire which after a days walking was so welcome. My wife has a garlic intolerance and although couldn’t have the pie or the roasties, it was still a good choice. What was also nice was the chef popped out to do a check with my wife as he does use garlic in his kitchen and want to check all was ok. Wife had the chicken dinner and I had the beef - only picky criticism on the chicken is it could have done with another stuffing ball but other than that both meals were full of flavour, well put together and well cooked. Full of flavour and you could taste each different aspect Had puddings too, I had a bit of pudding envy when my wife’s apple crumble came out whilst I had the sticky toffee - both were great, not over sweet and the crunch on the apples on the crumble was spot on. We will be back here as just so friendly and pints served in tankards!

site_logo

Karl F . 2024-04-01

MORE AT TripAdvisor

Amazing place and food was excellent

site_logo

Tracy Brooker-Carey . 2024-04-01

MORE AT Google

Received a lovely warm welcome. Enjoyed our food, had the early bird Friday offer 2 main meals for £20 which was good value. Wouldn't have been so happy paying full price as feel £15 for a baguette is very expensive

site_logo

LOUISE COOPER . 2024-04-01

MORE AT Google

Lovely hill side pub overlooking valley. Nice atmosphere with friendly staff and a good range of Timothy Taylor beers. Food looked very good and pub was clearly popular with plenty of people eating on both friday and saturday nights

site_logo

Derek Jenkins . 2024-03-25

MORE AT Google

Excellent food with good size portions and great service

site_logo

Alan Heathcote . 2024-03-18

MORE AT Google

Stopped for dinner and it was huge!!!! Really lovely meal in a Reyt Good Pub 😉

site_logo

mandy straw . 2024-03-14

MORE AT Google

Lovely countryside pub with amazing food and beers. Lovely staff. All at a reasonable price.

site_logo

Tony Dobson . 2024-03-04

MORE AT Google

hello! i went today. with my father, the environment is probably the most beautiful thing and constantly surprised me being there, i adored sitting and being in a little hidden restaurant in the hills. the waitresses? lovely, caring and always on point with what we asked. the food menu was unique and different from what’s in hebden. i love hebden and its unique features, the only thing that put down the rating was the food. which im guessing was just either us or the day we came on(?). i had the chicken baguette, which was very nice but the only thing that brought it down was the grilled charcoal chicken which im personally imo would be better if it was like a roast sunday dinner type chicken - since it didn’t mix well with the sage stuffing but that’s my own opinion. my father didn’t really like his meal, i didn’t try it but i had no opinion - the veggies were lukewarm or not properly hot, the beef was rather thin and he felt like it came from a supermarket packet rather than a good piece of beef - but that’s not my opinion my fathers and he felt like the mash was powdered..? of course, this isn’t to bring you guys down . as i loved my experience and if i could give y ou s five star i would. please don’t take this too personally at all, just a piece of constructive criticism and advice. will probably be coming back. :)

site_logo

bellbellbell . 2024-02-11

MORE AT Google

Me an my partner had the giant filled Yorkshire pudding and they weren't half filled! It initially came with no gravy but we digged in regardless and it was still absolutely delicious, we then asked for gravy and wow it stepped it up to another level! Both plates cleared and very happy bellies! The atmosphere in the pub was cosy and the fire was lovely to sit by, all staff were very friendly. Couldn't recommend this place enough we'll definitely be back

site_logo

Hannah Morrall . 2024-02-10

MORE AT Google

I had chilli & rice, was nice but tasted like mince was cooked in butter and it wasn't hot, to me a chilli should be quite spicey, my husband had Kong burger and loved it, the staff were fab, very polite and welcoming as it was our first time there, but we will go back again as other people's food looked great too lol 😆 look forward to seeing you again x

site_logo

paula O . 2024-02-10

MORE AT TripAdvisor

We were visiting family in the area and booked a room here for the night and the ambience in this beautiful quirky pub was amazing. The management and staff were all really welcoming and the food was amazing, the meat pie was simply delicious and the wife's fish and chips was fresh and plentiful.. As an ex publican myself the real ale selection was well kept and worth paying that bit extra for... We stayed the night in a lovely cosy, clean room and waking up to that view was simply breathtaking. Definatly will be back, its a pleasure to find a country pub that has retained its carachter with warm fires and a welcome to match ...

site_logo

OnAir45661660210 . 2024-01-24

MORE AT TripAdvisor

First time in the pub, we only called in for drink. It’s a proper pub with an open fire. The bar staff are polite & friendly. Will definitely call past again for a Sunday dinner because it looked and smelt very good.

site_logo

The Boy . 2024-01-21

MORE AT Google

Amazing food,service and location. Dog friendly too

site_logo

clare nicklin . 2024-01-13

MORE AT Google

Amazing amazing amazing. My husband and I have come to the Hare and Hounds ever since we moved to Hebden Bridge a year ago. Every time we have visited we have had incredible food, service and drinks and have always left happy. The Hare and Hounds is our treat after working for the week. Millie has made us feel welcome since day one, we now look forward to her warm welcome when we come and visit! We came in tonight at 5pm for a takeaway meal, 2 for £20 - bargain! Next thing we know, it's 11pm and we've been drinking and chatting all night having the best time (we'll just reheat our amazing food when we finally make it home!) On to the food - the most INCREDIBLE food in the world. Matty is an absolute artist! The meat is fresh and local and we have loved every meal we've ever had. We dream about the sticky toffee pudding and look forward to our next pudding! Thanks to Matty and all the chefs. James the landlord is the loveliest person you will ever meet. Thank you Hare and Hounds, here's to another year! Thanks guys, we love you! But massive shout out to Millie, we look forward to our weekly chats with you.

site_logo

AJ Fairley . 2024-01-13

MORE AT Google

We were stopping in Hebden Bridge and this looked like a lovely country pub not far from the town. We came in summer so be aware that you need to go up a massive hill to get there - if the weather is poor or you're not able bodied then you will need to consider going by car. One plus is that the walk back is much easier! We had a lovely meal here and they do classic pub food well. We had booked a table for 7.30pm and luckily we were slightly early as they apparently stopped serving food at 7.30pm! Maybe an idea to let people know? Unsure why they booked us in if that was when they stopped serving, but lucky we were early!

site_logo

BlarghBlargh . 2024-01-02

MORE AT TripAdvisor

Extortionate prices very disappointed will not go back. Needs to be made more affordable !! Your reply is extremely rude and not customer service friendly just because I don’t want to pay your prices does not mean I relegated to Wetherspoons which is what you are referring to - companies house is a public domain for anyone to look at. Perhaps you should check your accounts on there - I have.

site_logo

Carole Conroy . 2024-01-02

MORE AT Google

Booked a table for 2 here on a Sunday afternoon. Stunning views surround the pub, roaring fire inside, cosy and warm. The staff were really friendly and the food delicious. The chips were amazing, pie homemade. We both had pie, one of us had steak & Stilton and the other cheese, onion & potato. Huge portions! Desserts were also delicious and homemade. We were staying in a cottage a 5 minute walk away, would definitely return and recommend a visit.

site_logo

Travel53616440 . 2023-12-17

MORE AT TripAdvisor

with this pub having the name " the famous" hare and hounds we thought we'd give it a go, but we definatly wont be going back, the food was not nice, the cheese,onion and potato pie had at least half an inch thick pastry and the chips was very dry, the steak and landlords ale pie was the same, needless to say what a complete waste of money, neither of us hardly ate much, after travelling a 60 miles round trip id go as far as to say this is one of the worst pubs weve visited

site_logo

altayl0r1 . 2023-12-10

MORE AT TripAdvisor

My good lady and I stopped in Saturday 28th for an evening meal. We had pre-booked earlier that day via a WhatsApp link on the pub website. On arrival, we were greeted warmth by the bar staff and showed to a table in a snug area. Ordering at the bar, we both chose the Steak & Ale pie, myself with Stilton cheese and a portion of halloumi fries to share as a starter. I also ordered a pint of Timothy Taylor’s Landlord. Well, the beer was just outstanding. Hand pulled, creamy with that Landlord famous bitterness at the end. Honestly, I don’t think I’ve had a better pint of Landlord anywhere, ever. Then the starter arrived within five minutes. A large portion for one, but just right for two - we both agreed it was excellent. Not greasy like we’ve had elsewhere and served with a sweet chilli dip. Then the main event … well, you can see from the photo, it looked impressive. Then the taste …. Phenomenal is a word that just doesn’t do the food justice. Beautiful, tender steak and Stilton cheese, with a crisp, suet pastry …! Honestly, it was heaven - cooked to perfection. We both had an excellent t evening, meeting the landlord himself, the chef too and we ensured they knew how much we enjoyed the food good it was. We sat at the bar for a good couple of hours in what is a friendly, warm, quirky country pub that oozes what is special about the atmosphere and speciality of the good old British pub. We will be back in spring to enjoy the garden and views of the valley that we have been promised. In summary, I think this comment my wife said as we walked away sums up our evening. “Honestly, I could spend every Saturday night here for the rest of my life.”

site_logo

lumpsta68 . 2023-10-29

MORE AT TripAdvisor

We called into the Hare and Hounds just for a drink but the welcome we got made is so comfortable that we stayed to eat. The food was delicious. We both chose the Steak and Landlord's ale pie. The pastry was very good, meat lovely firm chunks and the gravy was the best I have tasted. As we had been travelling we had one only course and I had a soft drink but my husband had a pint of Landlord. Prices were good and the staff excellent. Would definitely recommend this pub. Loved watching the ducks and goats as we ate outside.

site_logo

Linda O . 2023-09-26

MORE AT TripAdvisor

Beautiful pub, massif hill climb to get to it, I think it needs more sign's to show where it is, We enjoyed the food, I had the fish and chips it was cooked very nice,the staff was nice and welcoming, the beer was pricy 2 pints 12 pound, we had the same drinks in the shoulder of mutton for a lot less.

site_logo

savanah1514351 . 2023-09-07

MORE AT TripAdvisor

Phoned to confirm a table for dinner available with dog as on holiday and can't leave her in rental cottage. Very friendly on the phone and on arrival. Sat at table 11 near bar, lovely views out onto the countryside. Big Jack burger was v good. meat, gherkins and plenty of flavour. Fish n chips and Gammon were good too. Beers well kept. Timothy Taylor Landlord.

site_logo

99GBcatherinet . 2023-08-17

MORE AT TripAdvisor

Lovely hidden gem, at the top of Hebden. Great hospitality, comfortable rooms. Perfect for weekend away with your dog. Roast dinner was great, and beers well kept. Will definitely return.

site_logo

Wendy H . 2023-07-22

MORE AT TripAdvisor

My wife told me about this a while so I thought with a bit of time on my hands we thought we would give it a go. Based on pics I'd seen online I thought I'd be in for a real treat. Sadly I was wrong. The wife ordered I think calamari and chips. Very small portion on a serving sort of cheeseboard thing. I ordered the steak and landlord ale pie. At £16.95 I thought I'd get a good meal....nope chips were nice, a few peas, a gravy boat and a pie...well portion of a pie the size of playing card was certainly not value for money. And if you do go avoid table 11 at the end of the bar. We went on a quiet day. And the girl who worked there simply stood overlooking our table. We were felt very intimidated by her presence. Even if she was getting any closer she could have shared my portion of pie. Was going to suggest to family. I won't bother!!!

site_logo

Ronyrourist . 2023-06-24

MORE AT TripAdvisor

Excellent. Very warm and welcoming upon arrival. Then, the food was amazing and prompt serve too. We will return after a really good first visit!

site_logo

trumpetforlife . 2023-06-17

MORE AT TripAdvisor

If you are thinking of going here and imposing your miserable self-importance on the lovely, ridiculously friendly people here that make the most sumptuous meals you can imagine, then please stay away. Here you are assured of the most unpretentious welcome by real people, in a real northern country pub. It's an absolute delight, and if anyone tells you different they are either liars, deluded or miserable so and sos.

site_logo

GrahamParker1962 . 2023-05-14

MORE AT TripAdvisor

We booked a table for 2 on 30/4/2023 . We were really impressed by the look and feel of the pub , very traditional and just the type of the pub that we like. The staff were really nice and friendly. I had the steak and ale pie, my partner had the roast beef dinner. Both meals were delicious and we really enjoyed them. My pie was one of the nicest steak and ale pies that I've ever eaten, 10/10. However, the one and only thing that disappointed us were the drinks prices. I appreciate that prices have gone up everywhere and we are in a cost of living crusis but £5.50 for a pint of landlord is very expensive compared to other Timothy Taylors pubs near to us in Oakworth/ Haworth. A bottle of zero alcohol corona cost us £5.80 which is really expensive. You wouldn't even pay that on Greek St in Leeds city centre. Before paying the bill we had said that we would like to start coming over to this pub regularly as we are only a short drive away but due to the drinks prices it will be more of a treat/special occasion place for us.

site_logo

andy g . 2023-05-01

MORE AT TripAdvisor

Visited over Easter with family. They didn't seem to know the details of the 2 mains for £20 offer but it was eventually sorted. For 2 pints ABK Weisbier and 2 pints of cola it was £22.90! Lovely location but the drinks prices let it down, so will not be returning.

site_logo

JulieGil . 2023-04-25

MORE AT TripAdvisor

We visited hebden in august 2021 and absolutely loved this pub…. It was part of the reason we came back for this Easter bank holiday. The pub is lovely, the staff are fab but I was really shocked at the bar prices for drinks….we had...

site_logo

melz78 . 2023-04-08

MORE AT TripAdvisor

What a lovely pub. We went twice in a weekend for food. Sunday lunch was amazing - lovely roast beef - plenty of meat with all the trimmings. Lovely bottle of red next to a roaring fire. The staff are so friendly - can’t recommend...

site_logo

victoriagilbert567 . 2023-02-19

MORE AT TripAdvisor

After seeing the pictures on social media and with it being fairly local we have been wanting to give it a try. We will not be going again!! We booked a table for 4pm and did not get seated or even sight of a menu...

site_logo

L419UNvictorias . 2023-02-19

MORE AT TripAdvisor

A pleasure to walk through the door great welcome a real landlord great beer food excellent if there were more dedicated publicans like you pubs would not be closings down live long and prosper

site_logo

Tizzy2023 . 2023-02-16

MORE AT TripAdvisor

We stopped by for an evening meal and I ordered the cheese, onion, potato and jalepeno pie, which unfortunately, was not edible, as the pastry was raw. The staff did not quibble and refunded the cost (the pie is not cheap at £15.95) and let...

site_logo

LoveCornwall31 . 2022-12-06

MORE AT TripAdvisor

Stayed for 2 nights at this lovely pub. Very cozy with log fires, lovely food and welcomimg bar area. We stayed in the family room, bed was very comfortable - bathroom is tiny but sufficient. Highly recommended. We also went in Hebden Bridge for breakfast...

site_logo

Safari60310088768 . 2022-11-13

MORE AT TripAdvisor

We ate here on Saturday night and it was exceptional from the minute we walked in. Food, atmosphere, staff and beer - all faultless. We will be back.

site_logo

Lisa C . 2022-11-01

MORE AT TripAdvisor

New to the hare and hounds, always on the look out for a little gem and this place certainly fits the bill, lovely atmosphere, cosy and friendly, fantastic food, good beer 🍺 the landlord and landlady are very welcoming and all the staff are great...

site_logo

Adyaccess . 2022-10-28

MORE AT TripAdvisor

This is a smashing pub. We sat outside and enjoyed the fabulous view: goats, ducks and chickens up close … with a panorama featuring Heptonstall and Stoodley Pike in the background! Stunning! Excellent food - we really enjoyed our meals. We had a veggie chilli,...

site_logo

Lucecas . 2022-08-25

MORE AT TripAdvisor

Similary restaurants in Yorkshire and The Humber

restaurant_img
4.3

766 Opinions

location-icon
British
outdoor_seating_163009takeaway_163009delivery_163009

Fantastic.. best wishes for 2025....

restaurant_img
4.3

2228 Opinions

location-iconLumbutts
British
outdoor_seating_130110takeaway_130110delivery_130110

We called in over the weekend. Plenty of car spaces which was good. The food was delicious, tasty and piping hot. Good selection of ales. Staff were good and the service was quick. Will call again in the future.

restaurant_img
4.3

1093 Opinions

location-iconFielden Square
British
outdoor_seating_129858takeaway_129858delivery_129858

Had 2 nights in here Fri,Sat last week. Great place for a night out. Polite,helpful staff and David Holmes gig which was fantastic

restaurant_img
4.3

1734 Opinions

location-iconLumbutts Road
British
outdoor_seating_130104takeaway_130104delivery_130104

Run out of essential foods including ice ! Staff looked about 16 yrs old and swearing in earshot with customers they knew. Won't go again

restaurant_img
4.3

321 Opinions

location-icon2 Halifax road
British
outdoor_seating_146675takeaway_146675delivery_146675

Great fish & chips! We really enjoyed it, crispy batter, lovely chips.