GastroRanking-logo
whatsappWhatsapp
phoneCalldesktopWebsite
menuMenu
bookingBooking
4.1

Based on 335 opinions finded in 4 websites

site_photo4

Nº 1042 in 1872 in Brighton and Hove

Nº 19 of 29 Thai in Brighton and Hove

CUSTOMERS TALK ABOUT DISHES WITH..noodlescoconutdumplingscookedriceprawnssquidduckspicychillifriedchickenprawnpaycurrypork

comment_iconOpinions

Fresh and high quality - exceptional service, too.

site_logo

Kim Terrell . 2024-12-15

MORE AT Google

Best Thai food in Brighton! Probably the best Thai food I’ve ever had anywhere in the UK. We’ll definitely be ordering frequently in the future! I had the Thai Hot Green Curry and my girlfriend had the Gaeng Andaman – both were packed with incredible flavors and cooked to perfection. On the side, we enjoyed a delicious pork belly dish and broccoli with ginger, which were equally fantastic. The service is top-notch too. They use their own delivery drivers who are always friendly and reliable at finding our address. Can’t recommend this place highly enough !

site_logo

Pete Mines . 2024-12-14

MORE AT Google

Very friendly. We only ordered starters to take away. Food was ready in less than 10 minutes and was very tasty. Dog welcome.

site_logo

Marty Mc Fly . 2024-10-15

MORE AT Google

Kemptown Thai is an excellent Thai takeaway. The quality of the food is fabulous, but it is pricey, it's restaurant prices. Worth it for a treat though. I particularly recommend the moo grob (roast pork). It's a pity they no longer do the papaya salad, but you can't have everything.

site_logo

Tim DW . 2024-09-18

MORE AT Google

10/10 Bit pricey but no regrets. “You only get what you pay for!” Bought their S/P Squid for starters which was perfect. Nice big portion cooked to perfection, actually enough to share! More rice noodles than I could eat. But absolutely lovely in plain mode with spring onions and soy sauce. The green king prawn curry was utterly mouth watering and couldn’t eat it all either! The sauce could have been a little bit thicker, but that’s just my preference. It was perfectly balanced with garlic and lemon grass. I ate this delightful two course dinner as a special treat, which I washed down with Waitrose Brut Prosecco. I honestly feel like I’ve been out for dinner. This is NOT takeaway standard. This is better than Sawadee on St James Street eating IN!!!! I was going out to get a cheap Chinese takeaway, which was closed…….i spent twice my budget, but I’m pleased I DID!!! Service at the counter was perfect handled and I waited less than 10 minutes on a very busy night. Already looking forward to my return visit. Thank you so much! I never felt so satisfied from a takeaway, ever. xXx

site_logo

Gary Springett . 2024-09-03

MORE AT Google

I must be missing something. But I have shared opinion of 3 people. For the massaman curry with duck, green curry with pork belly and prawn pad Thai. Firstly. Massaman curry ended up with chicken although we paid extra for duck. The green curry ended up with prawns though ordered pork belly. Mistakes happen. Two out of the 3 dishes were mistakes. And we were not informed that they were out of any of these proteins at time of ordering. Pad Thai was ‘bland as anything’ so my son said. The massaman was a sauce with some whole potato’s and white chicken pre cooked breast meat dropped into the sauce. My wife was so hungry she ate it and said it was just ok. My green curry with overcooked king prawns was sweet and watery. Overall a huge disappointment and this is what people are rating so well. This is not Thai. As we know it. Massaman is a deep flavoured rich curry thickly coating on commonly beef. Not bland boiled white chicken. Massaman does work very well with duck meat. Hence the choice. But really with such a poor sauce it wouldn’t have helped. Runny and lacking in peanuts or cashews or any kind of tamarind taste. My green curry with watery sweet sauce. Hardly any coconut milk or if there was some was so bland and sweet due to prodigious amount of sugar, watery courgettes a single strand of Thai basil and water chestnut sucking all the seasoning out of the curry. No balance with sweet and sour at all. Just sweet. I know without fact I could have made better with a curry paste from off the shelf, coconut milk and some creamed coconut for body. Very cheap quality. I didn’t taste the pad Thai. But this is favourite of my sons and he left most of it. Value for money. Average when you add your protein. I’m worried to try the other Thai restaurant on the other side of the road now that we have moved into the area. I hope they are not owned by the same people. In answer to restaurant reply. Take fact that Thai curries are all about balance of sweet and sour. Not just sour as they try to say. Green curry can be watery I agree. Great to pour over rice. I agree. No taste other than sweet. No balance don’t agree. Added sugar don’t agree. Massaman should be thick, if cut potatoes are used the sauce would thicken naturally. Instead whole baby potatoes added as after thought. White chicken. Steamed or boiled. You get the jist. The blandest of white meat dropped into sauce to take on no flavour. The stuff you put in sandwiches with mayonnaise not in my curry please! Texture to curry sauce of my mistake not chestnuts instead bamboo shoots makes no odds. A sauce with very little thought. Just bulk ingredients to look a little Asian.

site_logo

Murad Ahmed . 2024-09-03

MORE AT Google

Great food and very nice delivery driver too

site_logo

Keith . 2024-08-17

MORE AT Just Eat

Amazing quality food! Is great to have the option of choosing your level of spice on dishes too. Excellent quality meats and plenty of vegan options too.

site_logo

J . 2024-07-23

MORE AT Google

Love this Thai Take away!!! Tried lots off the menu, and all very good! But the Drunken Noodles are Amazing especially if you have them Thai hot…. 5 stars!!!!

site_logo

Scott W . 2024-05-21

MORE AT TripAdvisor

First time ordering got the spicy chicken drunken noodles was lit great portion size too and staff were very polite and welcoming

site_logo

Cameron Murphie . 2024-05-13

MORE AT Google

Amazing Pad Thai, you can ring your bell anytime =]

site_logo

Jordan Graham . 2024-05-02

MORE AT Google

Been a long time since I had a good Thai food salt n pepper squid is perfect I mean bang on

site_logo

Nichola Wilson . 2024-04-23

MORE AT Google

I ordered a meal. The satay was nice- but not great, the chicken was very dry. The tempura veg was inedible. The prawn crackers were burnt - really horrible and remain in their plastic bag. The paid Thai was pretty tasteless- thanks for the bag of dried chilli and garlic you supplied with the order- I’m confused?

site_logo

Jane C . 2024-04-20

MORE AT TripAdvisor

We had such a lovely time having the food made and served immaculately- taste was unparalleled- thanks guys!

site_logo

Tushar Kulkarni . 2024-04-02

MORE AT Google

Ordered a takeaway with free local delivery - it came quickly in around 20 minutes. The person who delivered was super friendly. Another review posted about the vegan Pad Thai being the best - I couldn't agree more! It was so tasty, there was plenty of tofu and vegetables and the portion size was generous. I'll have some for tomorrow (or later). I also ordered they veggie gyozas, which were delicious and crispy. Would definitely recommend and will be ordering again soon!

site_logo

Alice Bines . 2024-03-16

MORE AT Google

After having a full day work, I go to Kemp ThAi to be nourished. Their food is beautifully and lovingly done as I have spoken to the wonderful kitchen staff, fresh quality ingredients, fantastic generous size or portion and biodegradable packaging make it loving for myself and the planet. This is a fantastic place to get some wonderful food I would give it to 10 stars but it’s only allowed five here. I'll be definitely coming back for more🥰

site_logo

5Rhythms with Neda Nenadic . 2024-03-16

MORE AT Google

Ordered a takeaway. Spicy is I guess subjective- but I ordered a mild stir fry- it’s too spicy for me to eat and my mouth is burning- duck was also very tough. Very disappointed.

site_logo

Jane Cunningham . 2023-11-11

MORE AT Google

Had a delivery last night. Very quick. The food was absolutely delicious. I would make one comment and there is that the sauce is very runny. But great taste

site_logo

Abi Brown . 2023-09-03

MORE AT Google

Lovely food, lovely staff great tasting food

site_logo

Craig . 2023-08-25

MORE AT Google

Ordered for two primarily off of the Vegan Menu (Tofu Satay, Tom Kha Soup, Sweet and Sour, steamed brocci with hmginger and chilli, egg fried rice). Arrived quick and piping hot. Tasted great and wasnt at all greasy or too salty. Nice to have a take away that doesn't spike your insulin levels and have you feeling comatose!

site_logo

Marietou Camara . 2023-08-11

MORE AT Google

very efficient service (use the online ordering) and tasty food, all the meals we had were lovely apart from a pork dish which was over cooked and too chewy. Generous portions

site_logo

Naomi Akpan . 2023-08-08

MORE AT Google

Food is spot on. Fantastic for vegan options

site_logo

Nicola Wright . 2023-08-02

MORE AT Google

Best vegan Pad Thai take away in Brighton. Always go here. And the curries are sensational.

site_logo

K Holmes . 2023-07-18

MORE AT Google

Ordered for two primarily off of the Vegan Menu (Tofu Satay, Tom Kha Soup, Sweet and Sour, steamed brocci with hmginger and chilli, egg fried rice). Arrived quick and piping hot. Tasted great and wasnt at all greasy or too salty. Nice to have a take away that doesn't spike your insulin levels and have you feeling comatose!

site_logo

Mamoudou Barry . 2023-07-07

MORE AT Google

The best Thai food I've ever had. Can always guarantee it to be fresh and tasty!

site_logo

Louis . 2023-07-06

MORE AT Just Eat

very efficient service (use the online ordering) and tasty food, all the meals we had were lovely apart from a pork dish which was over cooked and too chewy. Generous portions

site_logo

Salaman Ali . 2023-06-26

MORE AT Google

This tastes like authentic Thai food, perfect blend of ingredients, delicious.

site_logo

Rohini . 2023-06-06

MORE AT Just Eat

Ordered from here many times. Had a bad takeaway once but thought it was an off day. However ordered again but even worse such a shame as the food used to be lovely! Won’t be ordering again.

site_logo

MrsT1008 . 2023-05-30

MORE AT TripAdvisor

First time ordering from this place as have recently moved. The won ton dumplings didn't seem like they were steamed as there was a lot of oil in the box with them. The tempura prawns were ok. Haven't tried the squid yet though.

site_logo

Letty . 2023-03-24

MORE AT Just Eat

Really tasty food. Very big portions to!

site_logo

Ryan . 2023-02-19

MORE AT Just Eat

Really expensive for mediocre food and small portions.

site_logo

ash . 2023-02-17

MORE AT Just Eat

Our food just simply didn’t ever arrive, they said they had a busy night and not enough drivers but despite the food not coming they said they don’t do refunds! So I just paid £40 for literally nothing!!

site_logo

Chris W . 2022-12-09

MORE AT TripAdvisor

Best Thai food I've had in ages

site_logo

Sammie . 2022-11-07

MORE AT Just Eat

So I thought I would try there moo groob and I was very disappointed the portion size for the money was a bit steep 14.95 and then had to order rice extra at 3.90 I have a friend who makes thia street food and when he served me this meal before I tried this I can honestly say his is far much tastier and even comes with proper green veg and the pork belly is more crunchy so safe to say I won’t be ordering from here again to expensive

site_logo

Tony . 2022-10-21

MORE AT Just Eat

Food was delicious and got to us earlier than expected. Recommended.

site_logo

Maria . 2022-07-21

MORE AT Just Eat

Disappointed with the tempura too chunky and just tasted boiled, cheap veg used. Red curry was very tasty its a shame i should of ordered a different dish to go with the curry

site_logo

Joanne . 2022-06-26

MORE AT Just Eat

Food wasn't as good as normal, 3 of the dishes I ordered were slightly under-cooked which meant I didn't eat them, so I have rated below what I normally would.

site_logo

Zoe . 2022-04-23

MORE AT Just Eat

Has ownership changed?? Been ordering from Kemp Thai for years and the food has been great. I ordered a month ago and the food tasted horrible but Thought it might be a blip. Ordered again and the same rice was awful o counted 3 slices of chicken in my green Thai curry which j would usually share but it wasn’t enough for one person. I called only to be told that’s the weight of chicken they put in their curries. The restaurant has really gone down hill never ordering from them again. Such a shame £50 waisted.

site_logo

MrsT1008 . 2022-01-22

MORE AT TripAdvisor

Amazing food and arrived hot, would order from here again

site_logo

Lisa . 2022-01-18

MORE AT Just Eat

Food was nice, but not piping hot. Delivery took 2 hours, when at the time of ordering the app said 45-60 mins. The restaurant were apologetic when I called. Nice food, but not worth the price or wait IMO.

site_logo

Jay . 2022-01-15

MORE AT Just Eat

Kemp Thai has always been my favourite take away , the cost is slightly more than the average but it use to be worth it - until tonight. I am so disappointed, what has changed apart from the packaging and the customer service. It arrived cold , the noodles were hard the curry separating and also cold. £52 pound is not cheap in these unprecedented times, therefore a call to let them know to be told put it in the microwave. Seriously , the lady at the end of the phone really didn’t care . Such a shame because a simple apology after the many take aways we have bought from them would have changed everything……. Don’t waste your hard earned money on them.

site_logo

Saltdea . 2021-12-11

MORE AT TripAdvisor

This place used to be my Friday night treat... but something has change... more than something maybe the staff in the kitchen or the ingredients... but definitely so different from what used to be. Shame

site_logo

sabau . 2021-10-02

MORE AT TripAdvisor

Very tasty and fresh. Probably one of the best takeaways I’ve had, consistently.

site_logo

Russell . 2021-09-25

MORE AT Just Eat

Kemp Thai produce the best Thai food I have ever tasted. I’ve only ever had a takeaway from them but seriously, if you haven’t tried them, you have to. I don’t consider myself to be an expert in Thai food but I know what I like and everything now will get compared to this place as the benchmark. Thank you for producing such beautiful food.

site_logo

NathanFryer . 2021-09-05

MORE AT TripAdvisor

Lovely Thai.. delivered on time and hot!

site_logo

Paul . 2021-08-06

MORE AT Just Eat

Food was delicious! Prawn tempura was perfectly crispy & juicy and the salt and peppered squid was so tasty I couldn't stop eating it. Love this place it never disappoints

site_logo

Elizabeth . 2021-07-31

MORE AT Just Eat

Hands down the best Thai meal we’ve had in a long time. We ordered a selection of items all of which were fresh, delicious and the perfect temperature. Good portions for the price. The restaurant called me to inform me that one of the ordered items wasn’t available and asked if there was anything else we would like instead which was a nice touch. Highly recommend if you like Thai food.

site_logo

samuel . 2021-05-30

MORE AT Just Eat

I have been visiting Brighton for study and ordered food for Kemp Thai regularly. Every dish has been amazing. Vibrant and delicious, I would not hesitate to order from this lovely eatery. Tonight's pork dumplings were a thing of beauty. The duck was plentiful, tender and so tasty, Please come back home with me and open a branch in Cardiff!

site_logo

adeleoddy . 2021-05-22

MORE AT TripAdvisor

This food is sooo addicted! I really wanted to take photos of dish, but I ate it far too last. With tofu satay you will go never wrong. We love you, please do not ever change your kitchen! Very happy customer.

site_logo

Blondska17 . 2021-05-15

MORE AT TripAdvisor

An absolutely delicious meal and the best presented takeaway I’ve had!

site_logo

Miztli . 2021-05-04

MORE AT Just Eat

Thanks for an incredible meal. It was all stand out, we just didn’t want our dinner to end. It was even delivered early too.

site_logo

Nigel . 2021-04-14

MORE AT Just Eat

Tasty food, good portions, and no plastic waste!

site_logo

Julie . 2021-04-10

MORE AT Just Eat

Delicious food and I'm absolutely loving the compostable containers. Brilliant.

site_logo

Kate . 2021-04-01

MORE AT Just Eat

I would order again! Fabulous food and great quality

site_logo

Q . 2021-03-13

MORE AT Just Eat

This is the best Thai, I’ve ordered on Just Eat. Great fresh and well prepared ingredients, well spiced with no corners cut. Gluten free options. Delivered in eco friendly packaging, what’s not to like!

site_logo

Roger . 2021-03-13

MORE AT Just Eat

Ordered 2 curry's but got 2 pots of mostly onions a few potatoes and slither of meat.

site_logo

Allan . 2021-03-10

MORE AT Just Eat

Delivery late and food cold. Too expensive for what it is. Spring vegetable rolls too cold...Food tastes good.

site_logo

Soha . 2021-03-06

MORE AT Just Eat

Excellent .. hot and tasty and early !!

site_logo

Nicholas . 2021-02-27

MORE AT Just Eat

Honestly the best Thai food I have eaten in so long

site_logo

Sammy . 2021-02-18

MORE AT Just Eat

Delicious! Very generous portions, a delightful mix of flavours and textures. We will be ordering from them again soon!

site_logo

harriet . 2021-01-30

MORE AT Just Eat

Sustainable packages, huge portion of prawn crackers and really tasty gyoza! Only criticism was Chicken satay was a little on the dry side.

site_logo

Lindsay . 2021-01-29

MORE AT Just Eat

This is hands down the best Thai food I have had and their packaging is eco! I won't get Thai from anywhere else from now on.

site_logo

Olivia Cook . 2021-01-17

MORE AT Google

The rice was virtually hard. My kids had to use a knife to cut through it, they refused to eat it in the end, awful. Massaman curry had way way too much onion in it and very little potato. Curry sauce was ok but lacking spices such as a nice Star Anise flavour. Beef was rather chewy but good amount Pork Gyoza tasted like smoked bacon!? Absolutely lacked any ginger flavour or any other spices just smoked bacon, no real pork flavour at all. Spring rolls were nice. I didn't want a whole bottle of chillie sauce. £1 for satay sauce was a bit steep. Very Expensive!! For what we got I felt it was extremely expensive and dissapointing. Such a shame. Once bitten.....

site_logo

Mark . 2021-01-13

MORE AT Just Eat

The best Thai we have tried in Brighton.

site_logo

Matt . 2020-12-24

MORE AT Just Eat

Delicious as always. Best Thai curries in town

site_logo

Dominick . 2020-12-19

MORE AT Just Eat

We just had this take away delivered and the vegan massaman and green curries with coconut rice and chill and garlic rice long with satay tofu and it was fresh and utterly delicious. All the veggies were perfectly cooked. We liked the fact that veggies were obviously fresh and not soggy. It was a real treat and we think the packaging is a nice touch (biodegradable and compostable).Well done Kemp Thai. We will be back for more that's for sure.

site_logo

Helenbaxter1010 . 2020-12-15

MORE AT TripAdvisor

Best Thai EVER! I order here all the time and am always delighted. 10/10.

site_logo

ELLA . 2020-12-12

MORE AT Just Eat

Absolutely delicious food. Best Thai in Brighton. Flavours and textures and choice all spot on!! I want it again already.

site_logo

ELLA . 2020-11-27

MORE AT Just Eat

Fantastic food and lovely delivery lady

site_logo

Andrea . 2020-11-13

MORE AT Just Eat

They really kindly called to say it would be very slightly late.

site_logo

Hannah . 2020-11-06

MORE AT Just Eat

Great flavour and loved the lack of plastic, nice biodegradable paper boxing. Keep up the great work :)

site_logo

Roger . 2020-11-04

MORE AT Just Eat

Lovely food and prompt delivery time

site_logo

Jon . 2020-10-31

MORE AT Just Eat

The first time to use kemp Thai My only regret is that I never used them before ! Fabulous packaging.....food amazing ..I ordered a vegan option which was so tasteful! And full of fresh vegetables. The best Thai green curry I have ever had ! I can’t wait to have my order again ! I recommend kemp Thai . 5 stars Thank you 🙏

site_logo

Dee . 2020-10-25

MORE AT Just Eat

The best Thai food around, we are always awkward as well and ask for the Pad Thai without egg and they always do it with no problems at all - two thumbs up! 👍🏻👍🏻

site_logo

Rob . 2020-10-25

MORE AT Just Eat

Bit late on delivery but well worth the wait. The food was amazing and we loved the new packaging cutting down on plastic containers. Will definitely order from this restaurant again.

site_logo

Alex . 2020-10-14

MORE AT Just Eat

Timely, warm, and delicious! Loved the cardboard delivery containers too.

site_logo

Stephen . 2020-10-09

MORE AT Just Eat

Driver left the food at the door (outside) and then didn't ring the doorbell resulting in ice cold food. Would not recommend.

site_logo

Tom . 2020-10-09

MORE AT Just Eat

lovely food, friendly service, fast delivery, what's not to like?

site_logo

Alex . 2020-09-20

MORE AT Just Eat

Amazing food, great delivery and massive portions

site_logo

Nic . 2020-09-15

MORE AT Just Eat

Not our 1st meal from Kemp Thai and as good as always. Delicious!

site_logo

Chris . 2020-09-12

MORE AT Just Eat

Excellent quality food, really delicious. Good portion sizes. Will definitely order again.

site_logo

Gabriel . 2020-09-09

MORE AT Just Eat

Beautifully balanced flavours, extremely well judged, hot and generous portions..

site_logo

John . 2020-09-04

MORE AT Just Eat

Such amazing Thai food! Great vegan options - Our favourite in Brighton :). Loving the new compostable packaging too.

site_logo

Megan . 2020-08-31

MORE AT Just Eat

Very disappointed with waiting over and hour and a half for our food.

site_logo

Scarlett . 2020-08-28

MORE AT Just Eat

Great food. Delivered fast. Plastic-free packaging.

site_logo

Peter . 2020-08-21

MORE AT Just Eat

Delicious food, speedy delivery. All my housemates were coming into the kitchen, asking what the delicious smell was and asking to try. Will be ordering from here again.

site_logo

Megan . 2020-08-12

MORE AT Just Eat

The food was for my son in a hotel. He was very happy with it.

site_logo

M . 2020-08-10

MORE AT Just Eat

My son and his friend enjoyed their meal very much and delivery was timely.

site_logo

M . 2020-08-07

MORE AT Just Eat

Fantastic! All delicious, and generous portion sizes. Will definitely order again.

site_logo

Rebecca . 2020-08-06

MORE AT Just Eat

Very tasty and hot .. excellent .. and I like the carboard containers instead of plastic

site_logo

Nicholas . 2020-08-04

MORE AT Just Eat

Wonderful food as always, fantastic new bio-degradable packaging. Best Thai in Brighton A+++

site_logo

Richie . 2020-08-03

MORE AT Just Eat

They do not except card payment online and tell customers to ring a phone number in front of the shop. The woman behind the counter literally looks at customers and ignores phone calls and customers outside. Not seen anything like that before. Recommend other food places in Kemptown instead..

site_logo

justadvisingfortrips . 2020-07-29

MORE AT TripAdvisor

Not up to usual standard from the restaurant. Very disappointing, inclined not to order from there again

site_logo

Barnabas . 2020-07-22

MORE AT Just Eat

We ordered Dinner from Kemp Thai (via Deliveroo) at the weekend & it was the BEST Thai food we had all lockdown. It was Friday night so delivery was up to one hour - not a problem. There was an excellent selection of vegetarian & vegan food. I ordered the mixed vegetable tempura (the batter was amazing) then Tofu Andaman for my main. So full of flavour & a very generous portion of tofu in there too. The food arrived piping hot in cardboard containers. Such a delicious meal. Will definitely order from Kemp a Thai again. Highly recommended.

site_logo

bl0ndie72 . 2020-07-06

MORE AT TripAdvisor

Amazing Thai food. Hot, spicy and beautifully cooked. This one’s a keeper!

site_logo

John . 2020-07-02

MORE AT Just Eat

Always a treat. Hot, tasty and on time. One slight down point.... the cardboard containing holding the main dish melted as it was taken out of bag.... luckily over kitchen counter.

site_logo

Neil . 2020-06-28

MORE AT Just Eat

I’ve defo had better Thai food, this one was too sugary and didn’t give sauce for spring rolls or crackers for price of the meal.

site_logo

Tracey . 2020-06-13

MORE AT Just Eat

The order was placed via deliveroo but delivered by a restaurant owned driver. I live in a flat and use crutches to get around. He pressed the buzzer for entry 3 times. I allowed him entry 3 times. Eventually I struggled down 2 flights of stairs where I saw him sat in his car having abandoned my order on a communal wall where anyone could have taken it. He was more interested in his phone and I asked him to wind down his window. I asked him why he didn't enter like every other delivery driver who enters the communal hallway and steps back from the door. He said he talked to the intercom but couldn't hear me. I said clearly there must be something wrong. He said he didn't know but if you can't hear it's clear there is something wrong. Rather than use common sense and phone the telephone number on the order he dumped the ice cream. Apparently the restaurant owner told him not to enter any premises. I called the restaurant and he said he is putting his staff above the customers and I should have disclosed my use of crutches. I don't have to declare my medical conditions. Instead they should advertise their delivery policy. I told the manager I am local and a loyal restaurant customer who's custom could be lost over this. Surely a small gesture of goodwill would be fair. I'm not part of the compensation culture but I'm recovering from surgery and was left upset and anxious.

site_logo

stevenw805 . 2020-05-30

MORE AT TripAdvisor

Ordered delivery for my husband's surprise birthday meal during lockdown. Delivery arrived on time, and steaming hot, which I wasn't expecting as we live in Woodingdean. Food was absolutely delicious, and hubby was beyond happy! 100% recommend!

site_logo

Leebobs13 . 2020-05-19

MORE AT TripAdvisor

Amazing Thai food, not the cheapest around but definitely best quality and worth every penny

site_logo

Lucas . 2020-05-18

MORE AT Just Eat

Similary restaurants in South East

restaurant_img
4.2

320 Opinions

location-icon1A Richmond Parade
Thai
outdoor_seating_84682takeaway_84682delivery_84682

Strong depth of flavour, everything tasted well seasoned and made fresh with care. Service was very fast!

restaurant_img
4.0

3428 Opinions

location-iconThai Pad Thai 72 Dyke Road
Thai
outdoor_seating_84654takeaway_84654delivery_84654

We enjoyed a wonderful, delicious Thai dinner and such attentive, kind service! The ladies were absolutely first class hosts. Every dish was absolutely perfect. I’m a lifelong vegetarian and I studied Vegetarian Thai cooking in Chiang Mai, Thailand. This food was extremely authentic and reminded me of my time in Thailand. I highly recommend Thai Pad Thai for its authentic, flavorful Thai food, the wonderful service and its intimate, cozy atmosphere. My friend is not a vegetarian and he equally appreciated his selections. This restaurant is conveniently located just off the Seven Dials in Brighton. I highly recommend Thai Pad Thai and will definitely return . ⭐️⭐️⭐️⭐️⭐️

restaurant_img
4.0

237 Opinions

location-icon30 High Street
Thai
outdoor_seating_82072takeaway_82072delivery_82072

Myself and my family went here for a New Year’s Eve meal and were greeted with the rudest woman on earth. Tutting, rolling eyes, sighing and muttering things under her breath are only a small list of the rude, unpleasant things she would due during our time at Ros Thai. The restaurant is silent and there is more of a vibe at a wake. Food was bland and had no authentic Thai flavour - bog standard and not to mention took over an hour to arrive. Will not be returning ever again, would give 0 stars if possible.

restaurant_img
4.3

355 Opinions

location-icon24 Gardner Street
Thai
outdoor_seating_84246takeaway_84246delivery_84246

Great pasties and lovely service

restaurant_img
4.0

4 Opinions

location-icon50 Southover Street
Thai
outdoor_seating_227571takeaway_227571delivery_227571

Esta operación en el Charles Napier ofrece una excelente elección de lo que creo que es una relación calidad-precio tailandesa. Tuvimos la fuente para compartir como aperitivo, tuve un curry verde, mi amigo tenía rollitos de primavera. Estábamos al final de una tarde ocupada, así que fue un poco lento y se olvidó 1 orden. Sucede, pero no quita la buena comida. Los vinos en el bar tienen un precio razonable.