GastroRanking-logo
whatsappWhatsapp
phoneCall
desktopWebsite
menuMenu
bookingBooking
4.0

Based on 756 opinions finded in 1 websites

site_photo3

Nº 480 in 951 in Wigan

Nº 41 of 86 British in Wigan

CUSTOMERS TALK ABOUT DISHES WITH..potatopaylamboldcakepieonioncoffeebeansprawncreamsaladsteakladyeggpotatoescheesecookedchickenbacon
Score
OpinionsNoteTripAdvisor7564.0

comment_iconOpinions

Was once a great place, but now, along with the accompanied Premier Inn has decided to stiff the uk public by accomodating immigrants of fighting age, no families, just able bodied men. And closed the pub to simply cater for said immigrants from the hotel. Something is seriously wrong.

site_logo

Chris B . 2024-07-08

MORE AT TripAdvisor

Qué tragedia absoluta que este restaurante esté cerrado permanentemente. Cualquier falta de clientelismo puede atribuirse simplemente a los operadores de estacionamiento demasiado celosos. Hemos tenido muchos una gran comida aquí. Se echará de menos.

site_logo

Janet . 2024-06-02

MORE AT TripAdvisor

A great place to eat with a first class menu available at good prices. The service is quick, very efficient with the staff always being friendly and helpful. The Stone Cross really is an ideal way to start your working day or a relaxing morning if away on a break. I breakfast and dine here on a regular basis and have never been disappointed yet.

site_logo

Simon M . 2024-05-22

MORE AT TripAdvisor

Can highly recommend the breakfast with a wide range of choice, both hot and cold with limitless tea and coffee. It is excellent value at under £10. Cooked fresh so no food waiting on hot plates to serve yourself-makes such a difference to the taste and quality. Staff are extremely friendly and a warm welcome is guaranteed. I visit regularly so can also recommend the Sunday lunch.

site_logo

Rosemary H . 2024-04-19

MORE AT TripAdvisor

Just brilliant! Andy, Donna and Alaina, and the whole team are amazing! They’re all extremely helpful and friendly, and best of all they remember you. We’ve stayed at the Premier Inn attached multiple times over the past few years and always have breakfast (and dinner sometimes) at the Stonecross. Food is excellent and plentiful. We wouldn’t go anywhere else now!

site_logo

Debbie McC . 2024-03-16

MORE AT TripAdvisor

This place is UNBEATABLE, came today for breakfast and as soon as we stepped in, we were treated with the most amazing and friendly staff. They are definitely a happy staff as they were smiling constantly and so cheery and took time to talk to us. Such a warm and kind atmosphere really makes a place. The service and quality of food is outstanding and I just can not believe the value for money. So for £10 you have UNLIMITED continental, UNLIMITED cooked and UNLIMITED teas, coffees and juices. In addition to this, kids eat free up to the age of 15 (not that I have kids but what an offer). I live locally and can’t believe this is only my first time here for breakfast. It certainly won’t be my last!!! If you are in the area I totally reccommend you visit. I have taken some photos and one last thing, the coffee is all ground proper coffee. Thanks to all the staff who make this place extra special and work so hard. Lucy and Alaina served us… such warm and genuinely lovely people. Thank you everyone.

site_logo

S4nd0 . 2024-03-16

MORE AT TripAdvisor

Took mum for Lunch after booking online, the waitress Alaina looked after us fantastically well. The coffee was not right but it changed it for us immediately and the food was great.Mum really enjoyed her lunch and commented on how nice the waitress had been. I was also given a Loyalty card as mum does not live far from the restaurant so will be returning with her. Thankyou Aliana!

site_logo

W4022OOdavids . 2024-03-05

MORE AT TripAdvisor

No one took our order at table had to go bar every time we wanted something duty management unhelpful definitely not return to this table table worse one I’ve been to avoid it

site_logo

nigel713 . 2024-03-04

MORE AT TripAdvisor

Have been working away for a while and it was so good to get back to a terific breakfast and donna is still the best happy smiling and very helpfull a few ladies and 1 gent got close but still not as good as Donna. My only critisisum is the toaster is so slow.Going again tomorow its good to be able to come hear.

site_logo

keith s . 2024-02-24

MORE AT TripAdvisor

Had a lovely meal with my family, our waitress Taylor was very attentive and we felt really looked after by her and the rest of the staff. Thank you

site_logo

Emma T . 2024-02-14

MORE AT TripAdvisor

Donna is so welcoming and always caters for my needs as I have alternative milk. She is efficient and will always chat and make you feel welcome.

site_logo

Trail58964265953 . 2024-01-29

MORE AT TripAdvisor

Thankyou Alaina!!!! Me and my family arrived for some dinner. Alaina our waitress made us very comfortable and relaxed from the get go. My step daughter has a severe egg allergy and Alaina and the team made sure everything was safe for her. This is the first restaurant we have been to that we feel had taken the allergy concern seriously! So massive thankyou for that! The food was perfect (thankyou kitchen team! ) and beyond our expectations. Alaina’s customer service was amazing - she was always smiling and was always keeping updating us about our food order, especially due to the egg allergy. Thankyou so so so much Alaina and the team for making us feel safe for a place to eat and relax as a family. We will be back for sure!!!!

site_logo

Katie B . 2024-01-27

MORE AT TripAdvisor

We rang for a table and 15 minutes later we were warmly welcomed by the manager who quickly took our order. We helped ourself to cereal and coffees and within 10 minutes were tucking into our super breakfasts. The sausages were wholesome and tasty, delicious hash browns and almost fat-free bacon and beans gave me a great start to the day. After a rest with another coffee ( help yourself unlimited) I ordered scrambled egg, fried egg and another hash brown. My wife and I loved this way of dining. No trouble to the staff to help us, well-cooked food and just a very pleasing experience. At £20 for two we thought this was great value and we complimented the vigilant manager on running a well-balanced dining area with attentive staff, will of course return.

site_logo

Ken H . 2024-01-21

MORE AT TripAdvisor

very good value for the money meals ,had a combination of the club sandwich, the tika masala and the sausages and mash . the wait was a little on the long side (may have only had limited staff on) but all the meals were great value , well presented and tastily (club sandwich different but very nice ) pub unfortunately is looking a bit tired but still worth a visit

site_logo

Mark B . 2024-01-09

MORE AT TripAdvisor

The staff went out of their way to give us a great time. The vibe and atmosphere was so welcoming and set the tone for a lovely meal.

site_logo

Jenny P . 2024-01-04

MORE AT TripAdvisor

I visited for lunch with family in November. We had burger and nachos. The service is really swift and the waiting staff were friendly and easy to get their attention. The food was lovely and fresh, it was delicious. I didn’t try a dessert but the menu looked incredible. It’s a real family friendly place, definitely worth dropping by for a good feed!

site_logo

HelenF874 . 2024-01-01

MORE AT TripAdvisor

You always get wonderful food and great service here. I was here around Christmas and the atmosphere was lovely. They are really welcoming and help with food intolerance. This is a regular place for me

site_logo

976dorothyp . 2024-01-01

MORE AT TripAdvisor

I came here with my daughter as I wanted so nice food and I didn't want to cook and I wasn't disapointed. We both had steak as the chefs here cook it medium rare to perfection and it was here that she actually tired her first steak a few years ago, although this time we took advantage of the Xmas menu starters too. I didn't have a pudding but my daighter had Ice cream sundae with Cadbury dairy milk caramelt nibbles. They do have a meatless menu too and my favourites off there are the Thai grreen curry and The lasagne, but today was a steak day. We always have a great time here it's easy to get to as it's pretty much staright off the East Lancs and not that much of a detour on the way home, so if I've been stuck in traffic it's a no brainer. Although I didn't have it today, you can come from an unlimited breakfast, you order the food so it's cooked fresh each time rather than buffet style but you can order as much as or as many times as you like.

site_logo

MJFlanagan . 2024-01-01

MORE AT TripAdvisor

DREADFUL!!! Service was abysmal and food was so bad we walked out. The portions were so small. The small frozen meat pie was served with a dessert spoon of mash. Ordered beef chilli with my nachos and got a teaspoon of chilli. We spent five minutes looking for a staff member to complain to and agreed to pay for drinks and left untouched food on the table.

site_logo

Yvonne R . 2023-12-29

MORE AT TripAdvisor

Would visit here often while ordering off the afternoon value menu. This is the first time I’ve felt inclined to write a review regarding the gammon meal. Very thin and small gammon compared to past visits. Unfortunately won’t be ordering this again. Not value for...

site_logo

andyrH7292KU . 2023-12-22

MORE AT TripAdvisor

Thought we'd give the Stonecross another try, not been for over two years. Not sure if the older lady was the manager or senior, but she was unwelcoming and miserable. Had to get up and ask for condiments as we weren't asked when meals arrived,...

site_logo

CheshireMabel39 . 2023-11-25

MORE AT TripAdvisor

Staying at the Premier Inn next door and came twice for breakfast. Very impressed. A buffet continental choice and your order is taken for the cooked breakfast. Fast friendly service, food cooked to perfection and the restaurant was lovely and clean. I thoroughly enjoyed my...

site_logo

Mags B . 2023-10-02

MORE AT TripAdvisor

What a place. Just left after breakfast having had a verbal altercation with another guest, stood over the 'continental ' breakfast selection picking items up with his bare hands, putting them back in place, scratching his back, arm and nose, then selecting more items with...

site_logo

Companion09707148085 . 2023-09-23

MORE AT TripAdvisor

Emily was so patient and catered to our every need. She was so polite and made sure we were okay with drinks and if we enjoyed our food. Thanks for making our experience a good one 👍 I felt sad as I didn't have much...

site_logo

Emma P . 2023-09-22

MORE AT TripAdvisor

Warm welcome, our waitress was Lucy, she took our orders immediately and brought the drinks within a minute. The meals were fine, Pie Wednesday did the job for my wife, my son enjoyed his large fish and chips and I tried a tasty cheese and...

site_logo

Ken H . 2023-09-06

MORE AT TripAdvisor

I visit and stay here weekly with work and it is consistently excellent. This is standard pub food so it’s never going to be 5 star food but you know already know that before choosing to eat here. That said, the food is always hot,...

site_logo

engineerstu . 2023-07-12

MORE AT TripAdvisor

Good honest pub food in a nice environment I suppose. Would love the smothered platter to have some salad or veg in it though!

site_logo

151normanw . 2023-07-05

MORE AT TripAdvisor

We had a long wait for table and to order the food. The first table we were shown to had food on the floor under the table, looked disgusting on complaining we were moved to another table. The food when arrived was disappointing, I wouldn't...

site_logo

Mary J . 2023-06-26

MORE AT TripAdvisor

A lovely way to start the day warm welcome on entry then a well cooked breakfast toped off with continental from the buffet which was very well stocked and frequently filled up.

site_logo

k s . 2023-06-14

MORE AT TripAdvisor

I like to go hear with my grandpa every weekend, we always go for breakfast to keep in touch, the girls, especially Donna are amazing at their job, the food is top notch and the breakfast bar is always full topped up. They even cater...

site_logo

Lewis H . 2023-06-03

MORE AT TripAdvisor

My wife went to new york so i decided to go and have breakfast at table table Golborne and it was fantastic everything i ordered came quickly and the black pudding was the best ive ever had outside my house everything was cooked to perfection...

site_logo

paulhD1167UG . 2023-05-31

MORE AT TripAdvisor

A warm welcome from Donna who always has or table ready. Breakfast buffet lovely and well stocked up and great service from Dona and Rach breakfast cooked nice as ordered thank you.

site_logo

k s . 2023-05-07

MORE AT TripAdvisor

Tried the breakfast, really impressed with the offer. Drinks included too! Will bring the family next time. Would be good if I didn’t have to stand waiting at the machine for toast but that’s just being picky I think

site_logo

M3160OWliamb . 2023-05-03

MORE AT TripAdvisor

Came back here for a light lunch today and a few drinks with friends. Really nice little place inside and it’s a much friendlier and more welcoming pub than a few of the others in the area from my experience

site_logo

Q9156UVsteveb . 2023-05-02

MORE AT TripAdvisor

Had a great lunch time meal with my hubby . The lady who attended to us was so friendly and attentive . Her name was Sharon she could not do enough for us . What a lovely Lady ☺

site_logo

janetgB6058YO . 2019-11-07

MORE AT TripAdvisor

We attended this restaurant as a family for the first time. We were served by Sharon, who was run off her feet, but provided excellent service. The kids meals were on time and as the kids said ‘nice and tasty’. Myself and my girlfriend plumped for a burger each which was lovely and juicy. Would definitely go back, if you do ask for Sharon as your server, she’s ace!!!

site_logo

chrisbZ1149JU . 2019-11-04

MORE AT TripAdvisor

Called in on way home to Yorkshire having to divert due to motorway closure.Food was very average but what it lacked in food quality it more than made up for by the lovely waitress Sharon who was a credit to the resturant. She even gave my 5 year old grandson a goody bag for the onward journey because he was upset he wouldn’t make it home in time to go trick or treating.Thank you Sharon

site_logo

65annetteb . 2019-11-01

MORE AT TripAdvisor

Garlic and herb mushrooms and also potato dippers for starters were very nice, but slow in coming. I tried the new main meal of beef and doom bar encased pie (£12.99), but didn't like how it was served - on top of the mashed potato and 10 green beans. Didn't look at all as it did in the menu photograph. I felt the pie was on top to hide the smaller amounts of mash and green beans served. It was very nice though and I ate it all. My partner had Mozzarella Stuffed Chicken Wrapped in Pancetta (£14.99) which was quite nice but colder than it should have been; the sauce was in a jug and had a skin on it from standing. Overall the meal was nice but expensive, there is certainly room for improvement in the quality of service experienced on this occasion

site_logo

mikeapeter . 2019-10-30

MORE AT TripAdvisor

I visited here today with my husband, son and grandson. I cannot fault the staff. They were extremely helpful and friendly. However when our food arrived it was practically cold. I don't like to leave bad reviews but this was not good and I would not recommend only because of this.

site_logo

Joe J . 2019-10-26

MORE AT TripAdvisor

Yet again great food and service. Elana and Sharon were very attentive and friendly. We had had a long journey to return our daughter to university so to have fantastic service was a bonus. We only had main meals, but they were good value for money and very tasty.

site_logo

Janet L . 2019-10-25

MORE AT TripAdvisor

We regularly go to Stone's Cross for dinner but tonight was simply the best service we've received anywhere.We were waited on by Sharon and her service was just incredible. She went above and beyond with her customer service and was just so personable, but what's more she was brilliant to our little boy, so attentive to him as well as us (most food establishments tend to ignore the little people). Stones Cross, you've got an amazing staff member in Sharon!!Thanks Sharon

site_logo

Dubdebz . 2019-10-17

MORE AT TripAdvisor

Went today 6:30pm ordered 3 adult meals 2 childrens meals... still tasting the grease. Ordered a mixed grill £15 got a 1/4 of chicken breast thqt was cooked from frozen (rubbery texture not fresh) 1/4 gamon steak more fat and rind than gamon got messy fries... stale oil taste was prominent for an extra charge i was expecting a normal size but what i got was less than what the children were served. Ordered a kids burger the bun was solid child couldnt eat it. Ordered a chicken bites kids meal the bites were that solid they could be used with a fork. Ordered a streaky bacon and chicken breast adults meal again the chicken was rubbery and had an odd texture the messy fries orderd with them again tasted more of oil... The baby spilt ketchup on table used a baby wipe to clean it and OMG the dirt on the wet wipe from the table was disgusting. Its safe to safe table table we dont recommend and after a £50 food alone bill for food we are still tasting for the wrong reeason we won't be back.

site_logo

CMmS78 . 2019-10-09

MORE AT TripAdvisor

It is a lovely cosy restaurant with great food. Had a lovely relaxing meal out with friends with very good service.

site_logo

LancashirePal . 2019-10-07

MORE AT TripAdvisor

Sharon was just the nicest waitress, nothing was too much trouble. Food was amazing and plenty of it. Highly recommend for value and quality

site_logo

Gill J . 2019-10-06

MORE AT TripAdvisor

Extremely friendly staff. Lovely roast dinner and very quick service. Sharon served up and was polite, attentive and informative. Thank-you

site_logo

AngClaret18 . 2019-10-06

MORE AT TripAdvisor

I took my niece for breakfast prior to a hospital appointment on the 19th September. Immediately, Chris the Duty Manager, asked if we had been before for breakfast. We hadn't, so he explained everything clearly in a really friendly and professional manner. We had previously spent double the money at a 'top' hotel at Haydock Island which was rubbish and no-one guided us! The buffet (especially the fruit) was really fresh and the cooked breakfast was yummy. The service was great and it was excellent value for money. We are returning soon! Thank you Chris

site_logo

LuckyPipShamrock . 2019-10-02

MORE AT TripAdvisor

Had a great meal. The food was excellent and the drinks were good quality too. Sharon who served us was very friendly and helpful, really good service.

site_logo

petertE5226HQ . 2019-09-29

MORE AT TripAdvisor

Our fourth visit and, once again the food was lovely. Mum really enjoys the Chicken Forestiere. Sharon, our server, was great. We will be back.

site_logo

K8089GCvanessar . 2019-09-28

MORE AT TripAdvisor

My sister chose the venue but it was my first visit. Midweek lunch with the family. The staff were so helpful and friendly giving us plenty of time to choose our food, accommodating late arrivals to our group. We were given a booth and this make it extra special. Food was really nice, traditional pub food no different to other restaurants to be fair however the staff will be the reason I return. Big shout out to Sharon and the other ladies who helped to make our afternoon enjoyable.

site_logo

Paula G . 2019-09-26

MORE AT TripAdvisor

Family midweek tea using vouchers received in the post. Never been before but really impressed with the surroundings and food. Service was slow to start with but got better. Food was better than the pub grub we expected. Overall a great experience and felt relaxed in a quiet atmosphere. Will return.

site_logo

DMCMStHelensUK . 2019-09-22

MORE AT TripAdvisor

Service fantastic. Beautiful food, Sharon could not do enough to help and made our visit very enjoyable.

site_logo

Chris F . 2019-09-18

MORE AT TripAdvisor

First time at stone cross pub,lovely meal and lovely service by Sharon! would recommend and Would come again!

site_logo

Steglover96 . 2019-09-18

MORE AT TripAdvisor

We had a fantastic experience today here we booked a family breakfast for 15 people to celebrate my birthday. They situated us in our own area so it was very intimate. We got special attention from Sharon who was fab totally went over and above offering great service. The food was spot on a little wait for the cooked food but was perfect time to let our continental breakfast settle and catch up with each other and gave more unlimited fresh juice and coffee. As the kids ate free this was such an amazing affordable way of getting the family together. Would recommend in a heart beat

site_logo

Emma G . 2019-09-15

MORE AT TripAdvisor

Good food and didn't have to wait long. Waitress very friendly and polite and couldn't do enough for us. Would recommend the green thai curry, it was delicious.

site_logo

Jan V . 2019-09-14

MORE AT TripAdvisor

We ordered food and Sharon the waitress was excellent, very attentive without being intrusive, she advised us that our meals were on the way and ensured we had drinks, she was very jovial and one of the best servers we have encountered for a while to top if off my husband left his phone in the restaurant and we had to drive back thinking that’s it someone would have taken it but fortunately Sharon had retrieved the phone and put it behind the bar, a big grateful thank you for excellent customer service and honesty. A credit to the company I would recommend visiting this establishment based on the excellent customer service we received.

site_logo

Trish G . 2019-09-12

MORE AT TripAdvisor

Went for sisters birthday the staff was lovely the food was great again the staff came out with her cake and sang happy birthday another lovely night well done.

site_logo

debcullen0710 . 2019-09-08

MORE AT TripAdvisor

Thank you to all the staff at Stonecross. Me and my son had a great time together having dinner. The food was fantastic. But the best part was Sharon. She was great with my son, very polite and took him on and entertained him. Sharon was very quick with any of our requests for dinner and was very professional also. Will definitely be back again. Thank You

site_logo

jayjaypearson . 2019-08-31

MORE AT TripAdvisor

Food was great & the lady who served us, Sharon was fantastic. She couldn’t have helped us anymore if she tried!

site_logo

E4481INmichaelm . 2019-08-31

MORE AT TripAdvisor

Sharon is fantastic, my daughter turns 4 tomorrow and as we asked for the kids dessert and possibility of a candle, she said it’s sorted and produced a cake with Happy Birthday wrote on the plate - and also sang happy birthday, she went out of her way to do that absolute great customer service and also thanks to the chef for doing it for her x

site_logo

steley1981 . 2019-08-29

MORE AT TripAdvisor

Visited today, had a sharing platter myself which was very good. However by far the best reason for returning would be the service we received. Sharon looked after us, got me into a new drink which I can’t get enough of now (thatchers and blackcurrant) and made my little girls day. Food was B+, service A+++

site_logo

C299NAphilc . 2019-08-25

MORE AT TripAdvisor

Fantastic service by Sharon. Went out of her way to make our meal great. Best PI and restaurant we’ve stayed at so far and Sharon made that happen. Thanks Sharon!

site_logo

SJM933 . 2019-08-24

MORE AT TripAdvisor

There was 13 of us that booked a table for a family birthday. The service as excellent the staff very friendly. Food was great. Many thanks

site_logo

calhaynes . 2019-08-22

MORE AT TripAdvisor

Staff were extremely helpful. Particular mention to Sharon our waitress. She was great particularly with my toddler, extremely kind and patient.

site_logo

FamilyDL . 2019-08-16

MORE AT TripAdvisor

A lovely little pub, very handy if staying at the Premier Inn next door. Had an evening meal there and was impressed. Also back for a Full English breakfast the following morning. The pub is quite large so does not get overcrowded. Food quality was good and the staff very friendly and helpful. Standard beers on tap.

site_logo

Timmy_Hughes . 2019-08-16

MORE AT TripAdvisor

The waitress was fantastic (sharon) Extremely helpful and very pleasant 😀 Makes all the difference. They all should be like Sharon

site_logo

Lee W . 2019-08-15

MORE AT TripAdvisor

I took my daughter for lunch today for her 5th birthday. We were served by Chris, who went above and beyond to make my little girl feel special. He brought her a balloon and a birthday sign for our table, swapped her white napkins for pink ones, made sure her food order was correct and when he noticed she was sat low down in her chair, went to find her a cushion to sit on. All the time he spoke to her, he made sure to use her name which impressed me as it showed he was interested in my daughter and was ensuring that she was having a special time. After her meal, he brought her a special desert and sang to her. I cannot thank Chris enough for spoiling my little girl and giving her such a lovely experience. A definite asset to this restaurant. Highly recommend.

site_logo

Paula R . 2019-08-14

MORE AT TripAdvisor

Sharon G was a super friendly server, short wait times for food, excellent food, family friendly, would highly recommend eating here and we will definitely be back.

site_logo

Jennifer L . 2019-08-10

MORE AT TripAdvisor

Just been for a birthday meal for my son, the food was fantastic, brilliant service from the staff. Chris looked after us all really well. Thank you for a lovely time, will definitely be back soon

site_logo

Magsyhope . 2019-08-09

MORE AT TripAdvisor

We went here for lunch and were not disappointed. The food was fantastic and the service was excellent, our waitress Sharon was brilliant,polite and professional, a real credit to the team. We will definitely be going back again

site_logo

dl6295 . 2019-08-09

MORE AT TripAdvisor

We were staying on-site at the Premier Inn and couldn't be bothered going elsewhere. A 'Taste Card' knocking a considerable amount of money off the bill (even on a Saturday night) was also a big factor in our decision to eat here.I'm so glad we did. The staff were brilliant and extremely attentive. The food itself was delicious. We ended up having three courses in the end! Every one of the meals was lovely.Make sure you register your car on the touch-screen when you get there, or you'll end up with a parking invoice (they're not fines)!Highly recommended.

site_logo

CockneyBrum . 2019-08-05

MORE AT TripAdvisor

The food was very good and the staff were very helpful and cheerful I don't need to say anymore everything was just right

site_logo

avalea2019 . 2019-08-01

MORE AT TripAdvisor

Went for tea with mt friend. The food was utterly lush. Steak cooked to mouth watering perfection. The prices were really reasonable and we had fab service from Chris

site_logo

Lindsay K . 2019-07-31

MORE AT TripAdvisor

Thanks to Sharon our waitress for great service, much appreciated, she has served us whenever we visit, very good waitress

site_logo

rosaleen o . 2019-07-31

MORE AT TripAdvisor

Went for my retirement meal our waitress Sharon was so helpful and such a happy soul it was a true pleasure to be waited on by her a true credit to the stone cross

site_logo

Tobnvodka . 2019-07-31

MORE AT TripAdvisor

Visited here for a family get together for my wife’s mother’s 70th Birthday. We arrived early to hang some banners and balloons. The table was in use but the staff took the decorations and hung them for us later. They made a big fuss and gave us a free bottle of Prosecco which was lovely. The food was good and the staff were great. A big thank you to Megan, Leanna, Lucie & Lauren especially. Thanks all!

site_logo

Rog1313 . 2019-07-28

MORE AT TripAdvisor

We got served by Sharon G and we can't fault her service. She's so friendly and outgoing. We've been a few times and managed to have her wait on us. We have a laugh and joke and it always makes the visit. The food is cooked nice everytime. We haven't had a bad meal yet. One time we visited it was busy and Sharon was working her socks off as it was understaffed she never gave up and got on with it. She's definitely a great asset to your company.

site_logo

Natalie T . 2019-07-24

MORE AT TripAdvisor

So dissapointed last night, purposely sat in quiet alcove by door as hubby has mobility problems and didn't want to cause problems with his scooter.After ordering food and paying same as restraunt we had to get our own cutlery, sachets of sauce etc, we do this in McDonald's not when paying £14 for a burger. Maybe it's changed hands but food was not worth the amount.No one asked if meal was OK or even cared, sad to see a once nice pub being overtaken by miserable looking staff. When I go out for dinner and spend nearly 45 quid I expected more.

site_logo

Lynne M . 2019-07-23

MORE AT TripAdvisor

Excellent service from Sharon tonight when we attended for a family meal. She is very polite, efficient and very friendly.

site_logo

Blueberry_pops . 2019-07-21

MORE AT TripAdvisor

We only get chance to visit this place when we see family living nearby....we live in Sutton Coldfield about 80 miles away but it never disappoints us. Very welcoming and the food is excellent quality. See you again before Christmas!

site_logo

TonyT49er . 2019-07-21

MORE AT TripAdvisor

Food fantastic ,value for Money made all the more relaxing because our waitress Sharon made us feel welcome,cheerful and attentive without hovering x thanks Sharon lovely meal x

site_logo

Cheryl H . 2019-07-20

MORE AT TripAdvisor

What a fabulous time we had, Sharon was a brilliant asset. We had tye best meal abd was served very hot, and prompt.. Sharon was so entertaining and what a delightful character.. We will be back ❤️

site_logo

Richie R . 2019-07-14

MORE AT TripAdvisor

A very good night. Sharon our waitress was very pleasant and helpful, full of fun. Chris, the manager couldn't have been more helpful as I have food I tolerances. Well done you two. The food was perfect. Thanks

site_logo

Anne J . 2019-07-13

MORE AT TripAdvisor

As usual Sharon was most attentive, charming and efficient. We come most weeks and find the staff here to be friendly and helpful. Food seems to have improved recently - tonight’s meals were very nice.

site_logo

Matthew M . 2019-07-04

MORE AT TripAdvisor

Met up with friends for early meal. All our comments were favourable and all enjoyed their meals. I had the Chicken and Chorizo pie (not a traditional pie because the pastry was filo pastry and very light. It was served with boiled new potatoes (which could have been better). Our server was Sharon G who was very helpful and always pleasant.Would return to this restaurant.

site_logo

Bugsy75 . 2019-07-04

MORE AT TripAdvisor

Came for breakfast and it was lovely, all staff friendly and even brought out a cupcake for the birthday girl. Would definitely recommend!

site_logo

Ewalker97 . 2019-07-02

MORE AT TripAdvisor

We stayed at The Premier Inn next door and had the added extra of a meal deal for a two course meal, drink and breakfast. If that had not been the case we’d have left without eating.Service was painfully slow and a barmaid was serving pints with a mobile phone tucked on her shoulder. It wasn’t very clean, the glass divider was in dire need of a clean and the menus were grubby with food particles.I’d say the food was on par with my local Morrisons cafe. Actually, Morrisons is better.There was only one lady member of staff who seemed to be doing the jobs of everyone else and apologising profusely.We’d had some amazing meals on our holiday. This was the worst.

site_logo

evening_lilac . 2019-06-30

MORE AT TripAdvisor

When I eat out I would like a nice meal. You do not get the choice of eating a nice meal here. The food was hot .... and that’s the only positive. Even the salad choices were unhealthy. Table table really need to review there menu and put some healthy food choices and some tasty food choices instead of easy low cost to bulk buy options and then whack a massage mark up. I could produce this food at home, when I eat out I want something delicious that I wouldn’t generally have the time to prepare. Won’t eat at table table again without checking the menu has improved first. Very disappointing.

site_logo

O2921BCsarahs . 2019-06-26

MORE AT TripAdvisor

Another visit on business. Service was great, felt very welcomed, and the food was great. Under the new management this place is going places. Thanks for another nice evening.

site_logo

GavinBM . 2019-06-22

MORE AT TripAdvisor

Stopped here for a late lunch one Friday afternoon on our way to a family function nearby. We weren’t expecting haute cuisine, but when all’s said and done the food was great - we had fish, chips and peas and a couple of tuna and cheese ciabatta. The menu is fairly standard ‘pub grub’, but it was well cooked, tasty and filling. Drinks were not expensive. Handy location for anyone travelling between Manchester and Liverpool on the A580. Staff were friendly and attentive, but not pushy.

site_logo

472keithm . 2019-06-20

MORE AT TripAdvisor

Perfect food, amazing service and lovely staff, served my Chris, perfect! Food served very quickly and very hot and tasty.

site_logo

rose1mc . 2019-06-20

MORE AT TripAdvisor

We booked a table for Fathers day our first with our new Grandson .we ordered and was told by the waitress it was a 40 minute wait for food ....it wasn't that busy really but we waited when the food did arrive chips were cold and the butter was missing from my steak not great by any means

site_logo

jane r . 2019-06-16

MORE AT TripAdvisor

Turned up to be ignored by 5 staff, eventually served but no drinks on draught, not even an explanation why......

site_logo

alun h . 2019-06-15

MORE AT TripAdvisor

Food average but the main reason for the low rating was the staff. I was asked if I wanted to order a drink which I did but unfortunately it never arrived. I thought that the waitress had just forgotten and rather than embarrass her I just went and got one from the bar. However when the bill arrived I had been charged for the drink. I assumed it was a genuine mistake but when I raised the point the waitress insisted that she served it to me when she brought the main courses . . . . . even though she never served the main courses, it was a different waitress who served them. To his credit the manager refunded the cost but I was left feeling as though I was trying it on. Not happy

site_logo

Jeff G . 2019-06-15

MORE AT TripAdvisor

The lovely wonderful chris! Great customer service! Deserves a payrise and promotion. So refreshing to have someone care in a restaurant.

site_logo

AndreaH1069 . 2019-06-07

MORE AT TripAdvisor

been here a few tines for breakfast. we always enjoy. plenty of choice and self service which we like. cooked breakfast nice enough. will return.

site_logo

kerrybamber . 2019-06-07

MORE AT TripAdvisor

I love that this is my local! I treated my mum and dad to lunch here a little while ago and we all really enjoyed our food. The staff are always nice and there's always a great menu that changes occasionally to give you more choice and new things to try. Good selection behind the bar too and we love the outdoor seating when the weather's nice

site_logo

MrsGriff13 . 2019-06-02

MORE AT TripAdvisor

As a hard working chap... My end of week treat is a full English breakfast. It's always cooked the way I want it... The staff are always exceptional even the cleaning staff who'll take time to day hello. Big thanks to the regular staff I meet every week.. Chris Lisa and Jess. All a credit to the restaurant and add to an already enjoyable great value breakfast.

site_logo

chriscY957KF . 2019-05-27

MORE AT TripAdvisor

Chris and Lisa provided a fantastic and friendly service. Lovely environment and food. Would highly recommend for a visit.

site_logo

Diane B . 2019-05-27

MORE AT TripAdvisor

Went in today for breakfast and was greeted by Chris who showed us to our seat and from moment one, the experience was relaxing and enjoyable. You can see the breakfast team if Chris and Julie was first rate. If your ever in Golborne and struggling to find somewhere for breakfast or food or drink. Stop off here, you won't regret it, I never do.

site_logo

philipAlmon . 2019-05-22

MORE AT TripAdvisor

We went for a meal here 4 adults and 2 children.one of the children is milk intolerant so they were extra careful with her food.The meals were lovely desserts were good and the staff were polite friendly and nothing was to much trouble Would definitely recommend and will be back

site_logo

Dawn E . 2019-05-16

MORE AT TripAdvisor

Similary restaurants in North West

restaurant_img
4.0

12 Opinions

location-icon233 Church Road
British
outdoor_seating_210644takeaway_210644delivery_210644

Food was lovely But Ordered the chorito, which is a ready made wrap with chicken and rice, the chicken still had bones in it. Phoned to tell them and it was blamed on their supplier, dangerous!

restaurant_img
4.0

129 Opinions

location-icon54 Marsh Green
British
outdoor_seating_233758takeaway_233758delivery_233758

Food was delivered within 10 minutes. Always fresh and tasty. Protein sizes are always large. Definitely my go to chippy. 100% what’s needed on a wet and miserable night like tonight. Keep up the good work!

restaurant_img
4.0

757 Opinions

location-iconYew Tree Way
British
outdoor_seating_152492takeaway_152492delivery_152492

Took mum for Lunch after booking online, the waitress Alaina looked after us fantastically well. The coffee was not right but it changed it for us immediately and the food was great.Mum really enjoyed her lunch and commented on how nice the waitress had been. I was also given a Loyalty card as mum does not live far from the restaurant so will be returning with her. Thankyou Aliana!

restaurant_img
4.0

19 Opinions

location-icon94 Bradshawgate
British
outdoor_seating_147401takeaway_147401delivery_147401

We went to this cafe. Ordered x2 beef onion barms £10.00. Plus chips coffee and flat white coffee £18. . Let me start . Took ages and when we got our beef barms. With 1 piece of processed beef few onions on at £5.00 each. Shocking. No taste no beef !!! Chips dry. Coffee awful cost us £18. Absolutly robbery. Don’t go to this cafe . Shocking

restaurant_img
4.0

7003 Opinions

location-iconChaddock Lane, Astley
British
outdoor_seating_146927takeaway_146927delivery_146927

Visited a few times since the refurb. The unlimited refill drinks and unlimited veg on the carvery are really good! The staff are really friendly and helpful too.